DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mas and CG13527

DIOPT Version :9

Sequence 1:NP_523919.1 Gene:mas / 38499 FlyBaseID:FBgn0011653 Length:1047 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:231 Identity:66/231 - (28%)
Similarity:99/231 - (42%) Gaps:43/231 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   825 NQYLCGAALIGTQWVLTAAHCV---TNIVRSGDAIYVRVGDYDLTRKYGSPGAQTLR-VATTYIH 885
            |.| ||..|:..|||:||||||   :.|:.....:.|..|.....|.  :||..... |::.|:.
  Fly    59 NHY-CGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRY--TPGKSVCSPVSSLYVP 120

  Fly   886 HN---HNSQTLDNDIALLKLHGQAELRDGVCLVCLPARGVSH------AAGKRCTVTGYGYMGEA 941
            .|   ||:    .::||:||..:....|       |..|..|      ..|.|.||.|:|.|...
  Fly   121 KNFTMHNT----FNMALMKLQEKMPSND-------PRIGFLHLPKEAPKIGIRHTVLGWGRMYFG 174

  Fly   942 GPIPLRVREAEIPIVSDTECIRKVNAVTEKIF-ILPASSFCAGGEE---GHDACQGDGGGPLVCQ 1002
            ||:.:.:.:.::.::.        |||.:..| .......|||...   ..:.|.||.|.||:..
  Fly   175 GPLAVHIYQVDVVLMD--------NAVCKTYFRHYGDGMMCAGNNNWTIDAEPCSGDIGSPLLSG 231

  Fly  1003 DDGFYELAGLVSWGFGCGRQDVPGVYVKTSSFIGWI 1038
            .    .:.|:|::..|||..::|.||....|.:.||
  Fly   232 K----VVVGIVAYPIGCGCTNIPSVYTDVFSGLRWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
masNP_523919.1 Tryp_SPc 803..1041 CDD:238113 66/231 (29%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 66/231 (29%)
Tryp_SPc 43..263 CDD:214473 64/229 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456110
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.