DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mas and CG18477

DIOPT Version :9

Sequence 1:NP_523919.1 Gene:mas / 38499 FlyBaseID:FBgn0011653 Length:1047 Species:Drosophila melanogaster
Sequence 2:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster


Alignment Length:246 Identity:76/246 - (30%)
Similarity:119/246 - (48%) Gaps:19/246 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   810 ENGEWCWQVALINS-LNQYLCGAALIGTQWVLTAAHCVTNIVRSGDAIYVRVGDYDLTRKYGSPG 873
            :..|..|.|||::: .:.|:.|.|||....|:||.....|:..|  .:.||.|::|.:.|.....
  Fly   114 QEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTAS--QLVVRAGEWDFSTKTEQLP 176

  Fly   874 AQTLRVATTYIHHNHNSQTLDNDIALLKLHGQAELRDGVCLVCLPARGVSHAAGK-----RCTVT 933
            :..:.:.:...|...|.:...|::||:.|.........:..:|:|      :|.|     ||..|
  Fly   177 SVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMP------SAPKNFDFSRCIFT 235

  Fly   934 GYGYMGEAGPIPLRV-REAEIPIVSDTECIRKVNAVTEKIFILPASSFCAGGEEGHDACQGDGGG 997
            |:|......|..:.| ::..:|:|....|.:::.......|.|..|..|||||.|.|:|:||||.
  Fly   236 GWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGS 300

  Fly   998 PLVC---QDDGFYELAGLVSWGFGCGRQDVPGVYVKTSSFIGWINQIISVN 1045
            ||.|   .:...|||||:|::|..||...||.||...::.|.||. :.:||
  Fly   301 PLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWIT-LTTVN 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
masNP_523919.1 Tryp_SPc 803..1041 CDD:238113 74/240 (31%)
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 72/237 (30%)
Tryp_SPc 113..344 CDD:238113 72/237 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.