DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mas and CG4259

DIOPT Version :9

Sequence 1:NP_523919.1 Gene:mas / 38499 FlyBaseID:FBgn0011653 Length:1047 Species:Drosophila melanogaster
Sequence 2:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster


Alignment Length:301 Identity:71/301 - (23%)
Similarity:111/301 - (36%) Gaps:70/301 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   751 LVESSSLQSNQLRSYHNHQAQADQPDLVYPEYYQQRSLYGLQSNFSGRRRARVVGGEDGENGEWC 815
            ||.|.....||:|    .:.....|...:|                                   
  Fly    15 LVNSQYFNYNQIR----RETYGSNPRATFP----------------------------------- 40

  Fly   816 WQVALINS---LNQYLCGAALIGTQWVLTAAHCVTNIVRSGDAIYVRVGDYDLTRKYGSPGAQTL 877
            |.|::::.   |.:|:...:||....||||||.:....:..  :.||.|::| |..........|
  Fly    41 WVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYD--LVVRAGEWD-TSTTADQQHVDL 102

  Fly   878 RVATTYIHHNHNSQTLDNDIALLKLHGQAELRDGVCLVCLPARGVSHAAGKRCTVTGYG--YMGE 940
            .|.....|...|....:|::|||.|....|:...:.|:.|..:......|. |...|:|  |:..
  Fly   103 EVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKGS-CFFNGWGKVYLNS 166

  Fly   941 AGPIPLRVREAEIPIVSDTEC-IRKVNAVTEKIFILPASSFCAGGEEGHDACQGDGGGPLVCQDD 1004
            . ..|..::..::.::|...| .||          ||....|..|.||.| |.||||.||||:..
  Fly   167 T-DYPTVLKTVQVDLLSMGMCSSRK----------LPIQQICGKGLEGID-CSGDGGAPLVCRIL 219

  Fly  1005 GF---YELAGLVSWGFGCGRQDVPG---VYVKTSSFIGWIN 1039
            .:   |...|:|:|   ..::.|..   |:...:..:.||:
  Fly   220 TYPYKYAQVGIVNW---LSQKPVENTFIVFTNVAGLLPWID 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
masNP_523919.1 Tryp_SPc 803..1041 CDD:238113 63/249 (25%)
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 64/273 (23%)
Tryp_SPc 39..256 CDD:214473 62/270 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.