DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mas and gd

DIOPT Version :9

Sequence 1:NP_523919.1 Gene:mas / 38499 FlyBaseID:FBgn0011653 Length:1047 Species:Drosophila melanogaster
Sequence 2:NP_001259479.1 Gene:gd / 32159 FlyBaseID:FBgn0000808 Length:531 Species:Drosophila melanogaster


Alignment Length:307 Identity:70/307 - (22%)
Similarity:119/307 - (38%) Gaps:64/307 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   791 LQSNFSGRRRARVVGGEDGEN------GEWCWQVAL-INSLN--QYLCGAALIGTQWVLTAAHC- 845
            |:..|.....|..:..:..::      |.|.|..|: :|:|.  .:.||.:|:..:.|:::||| 
  Fly   233 LEHQFVDESEAEAIESDSADSLPSITRGSWPWLAAIYVNNLTSLDFQCGGSLVSARVVISSAHCF 297

  Fly   846 -VTNIVRSGDAIYVRVGDYDLTRKYGSPGAQTLRVATTYIHHNHNSQ--TLDNDIALLKLHGQAE 907
             :.|...:.:.:.|.:|.::| :.:...|:....|...|||.:.|||  :.|.|||::.|..:..
  Fly   298 KLFNKRYTSNEVLVFLGRHNL-KNWNEEGSLAAPVDGIYIHPDFNSQLSSYDADIAVIILKDEVR 361

  Fly   908 LRDGVCLVCL--PARGVSHAAGKRCTVTGYGY---------------MGEAGPIPLRVREAEIPI 955
            ....:...||  .:....:..|:|..|.|:.:               .|:........:..:.||
  Fly   362 FNTFIRPACLWSGSSKTEYIVGERGIVIGWSFDRTNRTRDQKLSSELPGKKSTDASAPKVVKAPI 426

  Fly   956 VSDTECIRKVNAVTEKIFILPASS---FCAG--GEE------GHDACQGDGGGPLVCQDDGFYEL 1009
            |.:.||.| .||....:     ||   ||||  .||      |.....|..|..|..:.:..:.|
  Fly   427 VGNAECFR-ANAHFRSL-----SSNRTFCAGIQAEERDTHQSGASIYTGISGAGLFIRRNNRWML 485

  Fly  1010 AGLVSWGFG--------------CGRQDVPGVYVKTSSFIGWINQII 1042
            .|.||....              |..|.:  :|...:.|:.||...:
  Fly   486 RGTVSAALPAVETPDAESSHKLCCKNQYI--IYADVAKFLDWITAFV 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
masNP_523919.1 Tryp_SPc 803..1041 CDD:238113 67/292 (23%)
gdNP_001259479.1 GD_N 27..124 CDD:292649
Tryp_SPc 257..526 CDD:238113 65/277 (23%)
Tryp_SPc 258..526 CDD:214473 65/276 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456118
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.