DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mas and CG30375

DIOPT Version :9

Sequence 1:NP_523919.1 Gene:mas / 38499 FlyBaseID:FBgn0011653 Length:1047 Species:Drosophila melanogaster
Sequence 2:NP_724665.1 Gene:CG30375 / 246575 FlyBaseID:FBgn0050375 Length:398 Species:Drosophila melanogaster


Alignment Length:317 Identity:82/317 - (25%)
Similarity:142/317 - (44%) Gaps:55/317 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   747 KLGDLVESSSLQSNQLRSYHNHQAQADQPDLVYPEYYQQRSLYGLQS-----------NFSGRRR 800
            ::|.:...|:.|:... :|::...|.           ||||....|:           :|..   
  Fly   101 RMGQVNRISNFQTMAF-AYYSSSPQT-----------QQRSRLNCQAVARPAPCDCGWSFPN--- 150

  Fly   801 ARVVGGEDGENGEWCWQVAL--INSLNQYLCGAALIGTQWVLTAAHCVTNIVRSGDAIYVRVGDY 863
             |:..|.:....|:...|.|  ::|.....||.:::..::::||||| |........:...||::
  Fly   151 -RIANGVEAGKHEFPSMVGLRDLSSNLPIFCGGSIVSERYIMTAAHC-TARQPVASRLLALVGEH 213

  Fly   864 DLTRKYGSPGAQTLRVA----TTYIHHNHNSQTLD---NDIALLKLHGQAELRDGVCLVCLPARG 921
            ||     |.||:::..|    ...|:|....:|..   ||||||:.....|...||..:|||.|.
  Fly   214 DL-----STGAESIYAAQYRIQNIINHPGYMETASGNINDIALLQTATPIEWSRGVAPICLPIRQ 273

  Fly   922 VSHAAG-KRCTVTGYGYMGEAGPIPLRVREAEIPIVSDTECIRKVNAVTEKIFILPASSFC---A 982
            ..::.. :...:.|:|.:|.|......:::|.:..:.:..|..:.|:     .|.| |..|   |
  Fly   274 AENSFNYQNVDIMGWGTLGFAASKSNTLQKATLLTMDNAVCRSRFNS-----SITP-SHLCTYDA 332

  Fly   983 GGEEGHDACQGDGGGPLVC-QDDGFYELAGLVSWGFGCGRQDVPGVYVKTSSFIGWI 1038
            || .|.|:||.|.|||::. |.:..::| |::|:|..||:....||..:.:|.:.|:
  Fly   333 GG-RGQDSCQYDSGGPVILRQRERMFQL-GVISYGRACGQPFGIGVNTRVTSHLNWL 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
masNP_523919.1 Tryp_SPc 803..1041 CDD:238113 70/250 (28%)
CG30375NP_724665.1 CUB 38..>100 CDD:294042
Tryp_SPc 151..386 CDD:214473 70/248 (28%)
Tryp_SPc 152..387 CDD:238113 69/248 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455993
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.