DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mas and CG30002

DIOPT Version :9

Sequence 1:NP_523919.1 Gene:mas / 38499 FlyBaseID:FBgn0011653 Length:1047 Species:Drosophila melanogaster
Sequence 2:NP_001163100.1 Gene:CG30002 / 246384 FlyBaseID:FBgn0260474 Length:311 Species:Drosophila melanogaster


Alignment Length:294 Identity:79/294 - (26%)
Similarity:120/294 - (40%) Gaps:60/294 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   777 LVYPEYYQQRSLYGLQSNF--SGRRRARVVGGEDGE--NGEWCWQVALINSLNQYLCGAALIGTQ 837
            |||....||..  |::||.  :.|.|..:.||....  :..|...:.:.:.|....||.:||...
  Fly    36 LVYENLTQQDC--GVRSNQIPAVRIRFMITGGRKSSLMSQPWMAFLHIASDLEMCRCGGSLISEL 98

  Fly   838 WVLTAAHCVTNIVRSGDAIYVRVGDYDLT----------RKYGSPGAQTLRVATTYIHHNHNSQT 892
            :|||||||.....||.: |.|.:|:.||:          .:..:|..:...:....:|...|...
  Fly    99 FVLTAAHCFKMCPRSKE-IRVWLGELDLSSTSDCTTYNYERVCAPPVEEFTIDKWILHEEFNLFY 162

  Fly   893 LDNDIALLKLHGQAELRDGVCLVCLPAR----GVSHAAGKRCTVTGYGYMGEAGPIPLRVREAEI 953
            ...||||:||:.:...:|.:..:|||..    ..:...|:|....|:|                 
  Fly   163 PGYDIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQLGQRFMAVGWG----------------- 210

  Fly   954 PIVSDTECIRKVNAV------TEKIFILPASSF-CAGGEEGHDACQGDGGGPLVCQDDGFYE--- 1008
                .||.:|..|:.      |||......:|| ||.|:. .|.|.||.||||:.:...|.:   
  Fly   211 ----KTESLRYANSTMEVDIRTEKCTDGRDTSFLCASGDY-VDTCNGDSGGPLLWKTTLFGKDRA 270

  Fly  1009 -LAGLVSWG---FGCGRQDVPGVYVKTSSFIGWI 1038
             ..|:||.|   .|.|.:   ..|:...:::.||
  Fly   271 VQFGVVSTGSQNCGAGHK---AYYMDVPTYMPWI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
masNP_523919.1 Tryp_SPc 803..1041 CDD:238113 69/266 (26%)
CG30002NP_001163100.1 Tryp_SPc 62..301 CDD:214473 67/264 (25%)
Tryp_SPc 62..301 CDD:238113 67/264 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456109
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.