DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mas and PRSS21

DIOPT Version :9

Sequence 1:NP_523919.1 Gene:mas / 38499 FlyBaseID:FBgn0011653 Length:1047 Species:Drosophila melanogaster
Sequence 2:NP_006790.1 Gene:PRSS21 / 10942 HGNCID:9485 Length:314 Species:Homo sapiens


Alignment Length:288 Identity:96/288 - (33%)
Similarity:136/288 - (47%) Gaps:38/288 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   780 PEYYQQRSLYGLQSNFSGRR--RARVVGGEDGENGEWCWQVALINSLNQYLCGAALIGTQWVLTA 842
            ||..:...|.|.    .|||  .:|:|||||.|.|.|.||.:| ...:.::||.:|:..:|.|||
Human    21 PESQEAAPLSGP----CGRRVITSRIVGGEDAELGRWPWQGSL-RLWDSHVCGVSLLSHRWALTA 80

  Fly   843 AHCVTNIVRSGD--AIYVRVGDYDLTRKYGSPGAQTLR--VATTYIHHNHNSQTLDN---DIALL 900
            |||........|  ...|:.|.......:.|..|...|  |:..|:    :.:.|.|   ||||:
Human    81 AHCFETYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYL----SPRYLGNSPYDIALV 141

  Fly   901 KLHGQAELRDGVCLVCLPARGVSHAAGKRCTVTGYGYM--GEAGPIPLRVREAEIPIVSDTEC-- 961
            ||.........:..:||.|..........|.|||:||:  .||.|.|..::|.::.|::::.|  
Human   142 KLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNH 206

  Fly   962 ------IRKVNAVTEKIFILPASSFCAGGEE-GHDACQGDGGGPLVCQDDGFYELAGLVSWGFGC 1019
                  .||      .||   ....|||..: |.|||.||.||||.|..:|.:...|:||||.||
Human   207 LFLKYSFRK------DIF---GDMVCAGNAQGGKDACFGDSGGPLACNKNGLWYQIGVVSWGVGC 262

  Fly  1020 GRQDVPGVYVKTSSFIGWINQIISVNNL 1047
            ||.:.||||...|....||.::::.:.:
Human   263 GRPNRPGVYTNISHHFEWIQKLMAQSGM 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
masNP_523919.1 Tryp_SPc 803..1041 CDD:238113 88/255 (35%)
PRSS21NP_006790.1 Tryp_SPc 42..283 CDD:238113 88/254 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.