DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and PRSS12

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_003610.2 Gene:PRSS12 / 8492 HGNCID:9477 Length:875 Species:Homo sapiens


Alignment Length:257 Identity:86/257 - (33%)
Similarity:127/257 - (49%) Gaps:28/257 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 KKIVGGEVSRKGAWPWIALLGYDDPSG-SPFKCGGTLITARHVLTAAHCIRQ-----DLQFVRLG 317
            |:|:||:.|.:|.|||...|......| ....||.||:::..|||||||.::     ....||:|
Human   629 KRIIGGKNSLRGGWPWQVSLRLKSSHGDGRLLCGATLLSSCWVLTAAHCFKRYGNSTRSYAVRVG 693

  Fly   318 EHDLSTDTETGHVDINIARYVSHPDYNRRNGRSDMAILYL----ERNVEFTSKIAPICLPHTANL 378
            ::......|. ..:|.:.:.|.|.:|.......|:|::.|    |:...|:|.:.|.|||.....
Human   694 DYHTLVPEEF-EEEIGVQQIVIHREYRPDRSDYDIALVRLQGPEEQCARFSSHVLPACLPLWRER 757

  Fly   379 RQKSYVGYMPFVAGWGKTMEGGESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCAG 443
            .||:....  ::.|||.|  |...::.|.:..||:...:.|      |:||  ..:|...:||||
Human   758 PQKTASNC--YITGWGDT--GRAYSRTLQQAAIPLLPKRFC------EERY--KGRFTGRMLCAG 810

  Fly   444 VLSGGK--DTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCARPNVPGVYSSTQYFMDWI 503
            .|...|  |:||||||||||...|.:.   :.:.||.|:|.||...:.||||:....|:.||
Human   811 NLHEHKRVDSCQGDSGGPLMCERPGES---WVVYGVTSWGYGCGVKDSPGVYTKVSAFVPWI 869

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 83/254 (33%)
Tryp_SPc 261..503 CDD:238113 83/253 (33%)
PRSS12NP_003610.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..88
KR 99..164 CDD:214527
SR 170..270 CDD:214555
SRCR 175..270 CDD:278931
SR 280..380 CDD:214555
SRCR 285..380 CDD:278931
SR 387..486 CDD:214555
SRCR 392..485 CDD:278931
SR 500..599 CDD:214555
SRCR 510..599 CDD:278931