DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and Tmprss5

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001346389.1 Gene:Tmprss5 / 80893 MGIID:1933407 Length:455 Species:Mus musculus


Alignment Length:354 Identity:108/354 - (30%)
Similarity:159/354 - (44%) Gaps:73/354 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 CASL------------LNELR-SRSQDATFANF-LRASNAVCQNKGTQVCCPTGQGITNTTPAPS 230
            |.||            |:::: :|||:  ||.. .|....|.::......||:|           
Mouse   148 CKSLGHIRLTQHKAVNLSDIKLNRSQE--FAQLSARPGGLVEESWKPSANCPSG----------- 199

  Fly   231 QIVPKNTDEIPRRLLNVEEGCGSTVGYFKKIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLI 295
            :||.....|           ||:. ....:||||:....|.|||.|.:    ..||...||.:::
Mouse   200 RIVSLKCSE-----------CGAR-PLASRIVGGQAVASGRWPWQASV----MLGSRHTCGASVL 248

  Fly   296 TARHVLTAAHCIRQDLQFVRLGE---HD--LSTDTETGHVDINIARYVSHPDYNRRNGRSDMAIL 355
            ....|:|||||: ...:..||..   |.  :|......|....:.:.:.||.|:.:|...|:|:|
Mouse   249 APHWVVTAAHCM-YSFRLSRLSSWRVHAGLVSHGAVRQHQGTMVEKIIPHPLYSAQNHDYDVALL 312

  Fly   356 YLERNVEFTSKIAPICLPHTANLRQKSYV-GYMPFVAGWGKT-MEGGESAQVLNELQIPIYD--- 415
            .|...:.|:..:..:|||    .:::.:. |...:|:|||.| .....|:..|.:..:|:..   
Mouse   313 QLRTPINFSDTVGAVCLP----AKEQHFPWGSQCWVSGWGHTDPSHTHSSDTLQDTMVPLLSTYL 373

  Fly   416 -NKVCVQSYAKEKRYFSADQFDKAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVS 479
             |..|:.|.|...|          :||||.|.|..|.|||||||||:.|   .|. .::|:||||
Mouse   374 CNSSCMYSGALTHR----------MLCAGYLDGRADACQGDSGGPLVCP---SGD-TWHLVGVVS 424

  Fly   480 YGIGCARPNVPGVYSSTQYFMDWIIQQVQ 508
            :|.|||.||.||||:....|:|||...||
Mouse   425 WGRGCAEPNRPGVYAKVAEFLDWIHDTVQ 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 11/49 (22%)
Tryp_SPc 260..503 CDD:214473 85/253 (34%)
Tryp_SPc 261..503 CDD:238113 85/252 (34%)
Tmprss5NP_001346389.1 SRCR_2 116..213 CDD:317845 19/89 (21%)
Tryp_SPc 217..448 CDD:214473 85/253 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.