DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and cfbl

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001077327.1 Gene:cfbl / 792472 ZFINID:ZDB-GENE-030131-2319 Length:751 Species:Danio rerio


Alignment Length:314 Identity:83/314 - (26%)
Similarity:137/314 - (43%) Gaps:72/314 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 KNTDEIPRRLLN-VEEG-----CGSTVGYFKKIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGT 293
            |:.|::.....| ::||     ||....|..:   .|..::..:||:|.:.....:|...||.|:
Zfish   435 KSLDDLKETFDNMIDEGNSVELCGLYKDYDDE---SESHKRRQYPWLAKISVTRSTGKNSKCMGS 496

  Fly   294 LITARHVLTAAHCIRQDLQFVRLGEHD----LSTDTETGHVDINIARYVSHPDYNRRNGRS---- 350
            .:|:..:||||||.:.|         |    ::.|.|:.:..|.:....||||||.:...:    
Zfish   497 FVTSSFILTAAHCFKVD---------DTPATITIDLESENQGIKVKYIHSHPDYNIKAKLNLGIP 552

  Fly   351 -----DMAILYLERNVEFTSKIAPICLPHTAN----LRQKSYVG--------YMPFVAGWGKTME 398
                 |:|:|.||:.|:.:..:.|||:|.|..    ||.....|        .|.     |:|::
Zfish   553 EYYEFDVALLQLEKPVKMSVSLRPICIPCTKETNGALRLSDREGTCKKHKELLMT-----GETVK 612

  Fly   399 GGESAQVLNELQ---IPIYDNKV---CVQSYAKEKRYFSADQFDKAV----LCAGVLSGGKD--T 451
            ....::|..:.:   |.|...|:   ||:. ||:....:|::....|    ||:|.:....|  .
Zfish   613 AAFMSEVRTKTEQKDITIKQGKLRQACVED-AKKAAGMTAEKATDIVTDNFLCSGGIDPTTDEIA 676

  Fly   452 CQGDSGG-PLMLPEPYQGQLRFYLIGVVSYGIG--CARPNVPGVYSSTQYFMDW 502
            |:||||| ..::|..     |...:|:||:|:.  |.|...|   .|..|..|:
Zfish   677 CKGDSGGATFVVPGG-----RVVQVGIVSWGVKDLCKRSPKP---RSESYTRDY 722

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 75/283 (27%)
Tryp_SPc 261..503 CDD:238113 75/282 (27%)
cfblNP_001077327.1 CCP 87..142 CDD:214478
CCP 149..202 CDD:153056
vWFA 250..445 CDD:294047 2/9 (22%)
Tryp_SPc 471..720 CDD:214473 73/271 (27%)
Tryp_SPc 471..720 CDD:238113 73/271 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.