DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and mettl7a.2

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_002933742.3 Gene:mettl7a.2 / 779612 XenbaseID:XB-GENE-22069551 Length:244 Species:Xenopus tropicalis


Alignment Length:87 Identity:21/87 - (24%)
Similarity:32/87 - (36%) Gaps:33/87 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   342 DYNRRNG---------RSD-------MAILYL----ERNVEF---TSKIAPICLPHTAN------ 377
            :|||:.|         .||       :|||.|    ..|.::   .||:.  |:....|      
 Frog    46 EYNRKMGDEKRQLFRNLSDFAGPSGKLAILDLGCGTGANFQYYPAGSKVT--CMDPNPNFKSFLG 108

  Fly   378 --LRQKSYVGYMPFVAGWGKTM 397
              |.:..:|.:..||...|:.|
 Frog   109 RSLAENQHVDFQSFVVAPGENM 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 21/87 (24%)
Tryp_SPc 261..503 CDD:238113 21/87 (24%)
mettl7a.2XP_002933742.3 Methyltransf_11 75..172 CDD:400514 13/58 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.