DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and Prss8

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_579929.1 Gene:Prss8 / 76560 MGIID:1923810 Length:339 Species:Mus musculus


Alignment Length:276 Identity:93/276 - (33%)
Similarity:138/276 - (50%) Gaps:36/276 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 EEGCGSTVGYFKKIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCI----R 308
            |..||:.:.  .:|.||..::.|.|||...:.||    ....|||:|::.:.|::||||.    .
Mouse    34 EASCGAVIQ--PRITGGGSAKPGQWPWQVSITYD----GNHVCGGSLVSNKWVVSAAHCFPREHS 92

  Fly   309 QDLQFVRLGEHDL---STDTETGHVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPI 370
            ::...|:||.|.|   |.||    |...:|:.::|..|.....:.|:|::.|...|.|:..|.||
Mouse    93 REAYEVKLGAHQLDSYSNDT----VVHTVAQIITHSSYREEGSQGDIALIRLSSPVTFSRYIRPI 153

  Fly   371 CLPHTANLRQKSYVGYMPFVAGWGKTMEGG--ESAQVLNELQIPIYDNKVC-----VQSYAKEKR 428
            ||| .||....:  |....|.|||......  ::.:.|.:|::|:...:.|     :.:..:|..
Mouse   154 CLP-AANASFPN--GLHCTVTGWGHVAPSVSLQTPRPLQQLEVPLISRETCSCLYNINAVPEEPH 215

  Fly   429 YFSADQFDKAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCARPNVPGVY 493
            ....|     :||||.:.||||.|||||||||..  |.:|  .:||.|:||:|..|..||.||||
Mouse   216 TIQQD-----MLCAGYVKGGKDACQGDSGGPLSC--PMEG--IWYLAGIVSWGDACGAPNRPGVY 271

  Fly   494 SSTQYFMDWIIQQVQD 509
            :.|..:..||...|.:
Mouse   272 TLTSTYASWIHHHVAE 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 87/256 (34%)
Tryp_SPc 261..503 CDD:238113 87/255 (34%)
Prss8NP_579929.1 Tryp_SPc 45..284 CDD:238113 89/258 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.