DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and Klk5

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_081082.1 Gene:Klk5 / 68668 MGIID:1915918 Length:293 Species:Mus musculus


Alignment Length:307 Identity:93/307 - (30%)
Similarity:139/307 - (45%) Gaps:56/307 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 PTGQGITNTTPAPSQIVPKNTDEIPRRLLNVEEGCGSTV--GYFKKIVGGEVSRKGAWPW--IAL 277
            |...|..::...||...|..|:    |.|:.:...|...  ....:||.|...:|.|.||  ..|
Mouse    26 PVLAGDVSSCDNPSGTEPSGTN----RDLSTDSKSGEDTRSDSSSRIVNGSDCQKDAQPWQGALL 86

  Fly   278 LGYDDPSGSPFK--CGGTLITARHVLTAAHCIRQDLQFVRLGEHDLSTDTETGHVDINIARYVSH 340
            ||       |.|  ||..||:.:.:|||||| |:.:..:|||.|.:|...|:|.......:.:.|
Mouse    87 LG-------PNKLYCGAVLISPQWLLTAAHC-RKPVFRIRLGHHSMSPVYESGQQMFQGIKSIPH 143

  Fly   341 PDYNRRNGRSDMAILYLERNVEFTSKIAPI-----CLPHTANLRQKSYVGYMPFVAGWGKTMEGG 400
            |.|:.....:|:.::.:.|.:..:..:.|:     |...          |....|:|||.|....
Mouse   144 PGYSHPGHSNDLMLIKMNRKIRDSHSVKPVEIACDCATE----------GTRCMVSGWGTTSSSH 198

  Fly   401 ES-AQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCAGVLSGGKDTCQGDSGGPLMLPE 464
            .: .:||..|.|.:...:.|..||        ..|.||.:.|||. ..|:|:||||||||::.  
Mouse   199 NNFPKVLQCLNITVLSEERCKNSY--------PGQIDKTMFCAGD-EEGRDSCQGDSGGPVVC-- 252

  Fly   465 PYQGQLRFYLIGVVSYG-IGCARPNVPGVYSSTQYFMDWIIQQVQDT 510
              .|:|:    |:||:| ..||:.|.||||::...|:.||    :||
Mouse   253 --NGKLQ----GLVSWGDFPCAQRNRPGVYTNLCEFVKWI----KDT 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 80/253 (32%)
Tryp_SPc 261..503 CDD:238113 80/252 (32%)
Klk5NP_081082.1 Tryp_SPc 67..286 CDD:214473 80/253 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.