DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and LOC683422

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_006252253.1 Gene:LOC683422 / 683422 RGDID:1586868 Length:312 Species:Rattus norvegicus


Alignment Length:253 Identity:74/253 - (29%)
Similarity:126/253 - (49%) Gaps:30/253 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 IVGGEVSRKGAWPW-IALLGYDDPSGSPFKCGGTLITARHVLTAAHCIRQ----DLQFVRLGEHD 320
            |:||:.:.....|| :.::.:     ....|||:::....||:|:||..|    :|: :|.|..|
  Rat    46 IMGGKPANISEVPWHVGIMNH-----GTHLCGGSILNEWWVLSASHCFDQINNANLE-IRHGRDD 104

  Fly   321 LSTDTETGHVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICLPHTANLRQKSYVG 385
            ||| ....|..::  :.:.||.::.....:|:|:|.|:..:..:....|||....::||    :.
  Rat   105 LST-KNVKHEKVD--KLILHPKFDDWLLDNDIALLLLKSPLNLSINGIPICTSELSDLR----IW 162

  Fly   386 YMPFVAGWGKTMEGGESAQV--LNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCAGVLSGG 448
            ...:|.|||.|...|...|.  |.::|:.::....|         .:......|.:||||...||
  Rat   163 KNCWVTGWGITNVSGVKVQTTKLQKVQVDLFRWDWC---------GYVLPLLTKNMLCAGTPDGG 218

  Fly   449 KDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCARPNVPGVYSSTQYFMDWIIQQ 506
            .|.|||||||.|:..:. :....:|.:|:||:|:||.:.|:||||:....::.||.:|
  Rat   219 MDACQGDSGGALVCNKK-RNINTWYQVGIVSWGVGCGKKNLPGVYTKVSPYLKWIRKQ 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 71/248 (29%)
Tryp_SPc 261..503 CDD:238113 71/248 (29%)
LOC683422XP_006252253.1 Tryp_SPc 46..275 CDD:238113 73/251 (29%)
Tryp_SPc 46..272 CDD:214473 71/248 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.