DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and st14a

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001035441.2 Gene:st14a / 678603 ZFINID:ZDB-GENE-030131-6496 Length:834 Species:Danio rerio


Alignment Length:395 Identity:123/395 - (31%)
Similarity:177/395 - (44%) Gaps:87/395 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 APLIEPRGTVCRGPDTKP--GNCVEIKECASLLNELRSRSQDATFANFLRASNAVCQN----KGT 212
            |.:|:.:..:|     ||  ..|..:.:|....:||...         .||....|:|    ...
Zfish   476 AKMIQCKNGLC-----KPMFWRCDGVDDCGDSTDELNCG---------CRADQFKCKNDKCISEK 526

  Fly   213 QVC-----CPTG---QGITNTTP--------APSQIVPKNTDEIPRRLLNVEEGCG--------- 252
            |.|     |..|   :|...|..        ..|:.:.|     |....:.::.||         
Zfish   527 QKCDGKDDCNDGSDEEGCARTDSCLVSTFLCGNSKCITK-----PNPECDGQDDCGDNSDESNCN 586

  Fly   253 -STVGYFK-KIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCIRQDLQF-- 313
             .|..|.| :||||:.:.:|.:||...|...:.:   ..|||::|..|.::|||||::.|::.  
Zfish   587 CGTKAYKKSRIVGGQDAFEGEFPWQVSLHIKNIA---HVCGGSIINERWIVTAAHCVQDDVKIKY 648

  Fly   314 -------VRLGEH---DLSTDTETGHVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIA 368
                   |.||.|   |..|.|:.     .:.:.:.||.||.....:|:|::.:|..|.|:..|.
Zfish   649 SQPGTWEVFLGLHSQKDKLTATKR-----LLKQVIPHPYYNAYTYDNDIALMEMESPVTFSDTIR 708

  Fly   369 PICLPHTANLRQKSYVGYMPFVAGWGKTMEGGESAQVLNELQIPIYDNKVCVQSYAKEKRYFSAD 433
            |:|||...:...   .|...|::|||.|.|||..|.||.:.::.|.::.||.|        ....
Zfish   709 PVCLPTATDTFP---AGTSVFISGWGATREGGSGATVLQKAEVRIINSTVCNQ--------LMGG 762

  Fly   434 QFDKAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCARPNVPGVYSSTQY 498
            |....:.||||||||.|.|||||||||..|   .|: |.:|.||||:|.||||.|.||:||:...
Zfish   763 QITSRMTCAGVLSGGVDACQGDSGGPLSFP---SGK-RMFLAGVVSWGDGCARRNKPGIYSNVPK 823

  Fly   499 FMDWI 503
            |..||
Zfish   824 FRAWI 828

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 13/62 (21%)
Tryp_SPc 260..503 CDD:214473 94/254 (37%)
Tryp_SPc 261..503 CDD:238113 94/253 (37%)
st14aNP_001035441.2 SEA 77..168 CDD:279699
CUB 219..322 CDD:238001
CUB 329..431 CDD:238001
LDLa 443..472 CDD:238060
LDLa 474..508 CDD:238060 9/36 (25%)
LDLa 510..544 CDD:238060 8/33 (24%)
LDLa 550..585 CDD:238060 5/39 (13%)
Tryp_SPc 596..828 CDD:214473 94/254 (37%)
Tryp_SPc 597..831 CDD:238113 96/255 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.