DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and 2210010C04Rik

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_075822.3 Gene:2210010C04Rik / 67373 MGIID:1914623 Length:247 Species:Mus musculus


Alignment Length:249 Identity:89/249 - (35%)
Similarity:135/249 - (54%) Gaps:29/249 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 KIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCIRQDLQFVRLGEHDLSTD 324
            |||||...::.|.|:...|.    ||..| |||:||.::.|::||||.:..:| ||||||::.. 
Mouse    24 KIVGGYTCQRNALPYQVSLN----SGYHF-CGGSLINSQWVVSAAHCYKSRIQ-VRLGEHNIDA- 81

  Fly   325 TETGHVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICLPHTANLRQKSYVGYMPF 389
            .|.|...|:.|:.:.||:||.....:|:.::.|:......|:::.:.||     |.....|....
Mouse    82 LEGGEQFIDAAKIIRHPNYNANTYNNDIMLIKLKTAATLNSRVSTVALP-----RSCPSAGTRCL 141

  Fly   390 VAGWGKTMEGGES-AQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCAGVLSGGKDTCQ 453
            |:|||.|:..|.: ..:|..|..|:..:..|..||..:   .:::.|     |.|.|.||||:||
Mouse   142 VSGWGNTLSSGTNYPSLLQCLDAPVLSDSSCTSSYPGK---ITSNMF-----CLGFLEGGKDSCQ 198

  Fly   454 GDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCARPNVPGVYSSTQYFMDWIIQQV 507
            ||||||::.    .|||:    ||||:|.|||:...||||:....:::||.|.:
Mouse   199 GDSGGPVVC----NGQLQ----GVVSWGYGCAQRGKPGVYTKVCKYVNWIQQTI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 86/243 (35%)
Tryp_SPc 261..503 CDD:238113 85/242 (35%)
2210010C04RikNP_075822.3 Tryp_SPc 24..240 CDD:214473 86/243 (35%)
Tryp_SPc 25..243 CDD:238113 87/245 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.