DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and zgc:123295

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:272 Identity:93/272 - (34%)
Similarity:142/272 - (52%) Gaps:44/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 LNVEEGCG----STVGYFKKIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAH 305
            |||   ||    :|     |||||:.:..|:|||...|  ..|:.....|||:||....||:|||
Zfish    24 LNV---CGRAPLNT-----KIVGGQNAGAGSWPWQVSL--QSPTYGGHFCGGSLINKDWVLSAAH 78

  Fly   306 CIRQDLQ--FVRLGEHDLSTDTETG----HVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFT 364
            |.:..:.  .|:||     ..:::|    .:...:.:.::||:||..:..:|:|::.|:.:|.|.
Zfish    79 CFQDSIGTIMVKLG-----LQSQSGSNPYQITKTVVQVINHPNYNNPSNDNDIALVKLDSSVTFN 138

  Fly   365 SKIAPICLPHTANLRQKSY-VGYMPFVAGWGK-TMEGGESAQVLNELQIPIYDNKVCVQSYAKEK 427
            ..|.|:||....|    :| .|.:.:|.|||| :....:...:|.|::|||..:..|.::|..| 
Zfish   139 DYIEPVCLAAAGN----TYAAGTLSWVTGWGKLSSAANQIPDILQEVEIPIVSHSDCKRAYPGE- 198

  Fly   428 RYFSADQFDKAVLCAGVL-SGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCARPNVPG 491
                   ....::|||:| .||||:||||||||::.....|    :...|:||:|.|||.|..||
Zfish   199 -------ITSNMICAGLLDQGGKDSCQGDSGGPMVSRNGSQ----WIQSGIVSFGRGCAEPGYPG 252

  Fly   492 VYSSTQYFMDWI 503
            ||:....:.|||
Zfish   253 VYARVSQYQDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 85/251 (34%)
Tryp_SPc 261..503 CDD:238113 84/250 (34%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 85/251 (34%)
Tryp_SPc 36..264 CDD:238113 84/250 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.