DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and zgc:123217

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001032480.1 Gene:zgc:123217 / 641414 ZFINID:ZDB-GENE-051113-188 Length:326 Species:Danio rerio


Alignment Length:259 Identity:87/259 - (33%)
Similarity:122/259 - (47%) Gaps:29/259 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 KIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCI---RQDLQFVRLGEHDL 321
            :||||..:..|:|||...:.|:    :...||||||.::.|:||||||   ..::..:.||....
Zfish    36 RIVGGTDAPAGSWPWQVSIHYN----NRHICGGTLIHSQWVMTAAHCIINTNINVWTLYLGRQTQ 96

  Fly   322 STD-TETGHVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICLPHTANLRQKSYVG 385
            ||. .....|.:.|...:.||.:|.....:|::::.|.:.|.|:..|.||||....::   .|.|
Zfish    97 STSVANPNEVKVGIQSIIDHPSFNNSLLNNDISLMKLSQPVNFSLYIRPICLAANNSI---FYNG 158

  Fly   386 YMPFVAGWGKTMEGGESA----QVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCAGVLS 446
            ...:..|||..  |.:.|    |.|.::|||:..|.:|...|..........|    ::|||  .
Zfish   159 TSCWATGWGNI--GKDQALPAPQTLQQVQIPVVANSLCSTEYESVNNATITPQ----MICAG--K 215

  Fly   447 GGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYG--IGCARPNVPGVYSSTQYFMDWIIQQVQ 508
            ..|.|||||||||....   ||.: :...|:.|||  .|||....|.|||....|..||...||
Zfish   216 ANKGTCQGDSGGPFQCK---QGSV-WIQAGITSYGTSAGCAVGAYPDVYSRVSEFQSWIKMNVQ 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 83/252 (33%)
Tryp_SPc 261..503 CDD:238113 83/251 (33%)
zgc:123217NP_001032480.1 Tryp_SPc 36..270 CDD:214473 83/252 (33%)
Tryp_SPc 37..273 CDD:238113 85/254 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.