DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and CG18754

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:366 Identity:99/366 - (27%)
Similarity:151/366 - (41%) Gaps:94/366 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 KPGNCVEIKECASLLNELRSRSQDATFANFLRASNAVCQNKGTQ------VCCPTGQGITNTTPA 228
            |...|..:..|:.|:|.||.|.......:............|.:      |||            
  Fly    32 KDEKCTRLVSCSPLMNILRPRGMTQAEKDVFAHRQCGLDPNGHELLHMVYVCC------------ 84

  Fly   229 PSQIVPKNTDEIPRRLLNVEEGCGSTVGYFKKIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGT 293
                 |:..|.:|.:     :.||.|...|:. .|.|.:....:||:.||.|::          .
  Fly    85 -----PELGDVLPNK-----QTCGQTTPVFRD-RGAENAELNEYPWMVLLLYEN----------R 128

  Fly   294 LITARHVLTAAHCI------RQD--LQFVRLGEHD---LSTDTETGHVDINIARYVSHPDYNRRN 347
            |...|:|||||||:      :.|  |:.|||||..   :::::...|:|:.:.:...|..:....
  Fly   129 LSLIRYVLTAAHCVIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSG 193

  Fly   348 G--RSDMAILYLERNVEFTSKIAPICL-----P-HTANLRQKSYVGYMPFVAGWGKTMEGGESAQ 404
            |  |:|:|:|.|:..|.:|.||.||||     | ...||:          ::||..|    :|:|
  Fly   194 GTYRNDIALLRLQFPVRYTKKIQPICLLDAEFPLQDLNLQ----------ISGWDPT----KSSQ 244

  Fly   405 VLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQ 469
            .|....:...:...|:..|..   :.||.|     :|||....| |||.|.||.|:|      |.
  Fly   245 TLITSTVKERNPADCLNRYPS---FRSASQ-----VCAGGQRKG-DTCAGISGSPVM------GI 294

  Fly   470 LR------FYLIGVVSYGIG-CARPNVPGVYSSTQYFMDWI 503
            :.      .:|.|:.|||.. |....:||||:...:|.:||
  Fly   295 MGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWI 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 10/51 (20%)
Tryp_SPc 260..503 CDD:214473 78/268 (29%)
Tryp_SPc 261..503 CDD:238113 78/267 (29%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855 9/48 (19%)
Tryp_SPc 108..338 CDD:238113 80/267 (30%)
Tryp_SPc 108..335 CDD:214473 78/265 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.