DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and si:dkeyp-93a5.3

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_021326347.1 Gene:si:dkeyp-93a5.3 / 571565 ZFINID:ZDB-GENE-131127-100 Length:328 Species:Danio rerio


Alignment Length:270 Identity:87/270 - (32%)
Similarity:120/270 - (44%) Gaps:48/270 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 KIVGGEVSRKGAWPWIALL----GYDDPSGSPFKCGGTLITARHVLTAAHCIRQDLQ---FVRLG 317
            :||||..:..|||||:..|    |:        .|||:||..:.||||||||.....   .|.||
Zfish    35 RIVGGVNATHGAWPWMVSLQGRYGH--------FCGGSLINNQWVLTAAHCIVDQTPSSIIVYLG 91

  Fly   318 EHDLSTDTETGHVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICL-PHTANLRQK 381
            :. .|...:...:...|...:.||.|:.....:|:|:|.|...|::|..|.|||| ...:|..: 
Zfish    92 KW-RSYVADVNSISRTIRHIIPHPSYSNITKDNDIALLQLTSTVQYTDYIKPICLADENSNFPR- 154

  Fly   382 SYVGYMPFVAGWGKT-------MEGGESAQV-------LNELQIPIYDNKVCVQSYAKEKRYFSA 432
               |...:|||||..       :.|..:..|       |.|.::.:|.|..|        .....
Zfish   155 ---GTNSWVAGWGDIGVLGTGGIRGRTTVSVPLPHPGILQEAELKVYSNADC--------NNICH 208

  Fly   433 DQFDKAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCARPNVPGVYSSTQ 497
            .:....::|||...|||.|..||||||||.......|     .||:|:|.|||:||:|.|:....
Zfish   209 GRITPNMICAGTRPGGKATFSGDSGGPLMTKCSVWVQ-----AGVLSHGYGCAQPNLPEVFIRVS 268

  Fly   498 YFMDWIIQQV 507
            .:..||...|
Zfish   269 EYKQWITGNV 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 84/264 (32%)
Tryp_SPc 261..503 CDD:238113 84/263 (32%)
si:dkeyp-93a5.3XP_021326347.1 Tryp_SPc 36..274 CDD:238113 84/263 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.