DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and AgaP_AGAP012035

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_001689264.1 Gene:AgaP_AGAP012035 / 5668016 VectorBaseID:AGAP012035 Length:197 Species:Anopheles gambiae


Alignment Length:181 Identity:44/181 - (24%)
Similarity:72/181 - (39%) Gaps:20/181 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 FNQRRQVRQNCITPENYYGSCVALTYCPQVVNIFQTTSRDRAQRY----VIALQRSCGTRSINGD 87
            |.||| |.|.||......|.|:.:..|.::|.:   |:|:....:    :.|:.|:|.:...:.|
Mosquito    30 FGQRR-VNQACILANGSSGRCIRIGECSKIVEL---TTRNVLYSWETQQIRAVLRACESDESSSD 90

  Fly    88 PVICCTEPRYNPVTERPRNPFFPSESTFIGPQPPPEVPDNPFLIPTPRTTTTTTTTTPAPIPDTS 152
            |::||...:..| |.|..|......:|......|......|..:   |.||..:||.....|.| 
Mosquito    91 PIVCCESAQSTP-TRRTLNSGVAPTTTTAASTTPIATTRRPTRV---RVTTQRSTTARRRTPTT- 150

  Fly   153 AAPLIEPRGTVCR---GPDTKPGNCVEIKECASLLNELRSRSQDATFANFL 200
                :..|.|..|   ..|..|..|.|.:...::.:::........:|.:|
Mosquito   151 ----VRTRSTTIRLDHFKDVLPARCGEQRPSWNVWSDIEDDDNIHVWAVYL 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829 14/59 (24%)
CLIP 164..216 CDD:288855 7/40 (18%)
Tryp_SPc 260..503 CDD:214473
Tryp_SPc 261..503 CDD:238113
AgaP_AGAP012035XP_001689264.1 CLIP 39..95 CDD:288855 13/58 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.