DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and AgaP_AGAP005690

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_001688708.1 Gene:AgaP_AGAP005690 / 5667342 VectorBaseID:AGAP005690 Length:300 Species:Anopheles gambiae


Alignment Length:266 Identity:80/266 - (30%)
Similarity:133/266 - (50%) Gaps:36/266 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 KIVGGEVSRKGAWPW-IALLGYDDPSGSPFKCGGTLITARHVLTAAHCIRQDLQFVR------LG 317
            :|..|:.:..|.:|: |||:. :..||:.. |||:::|...:||||||:......:.      :|
Mosquito    55 RITNGQEATPGQFPFQIALIS-EFASGNGL-CGGSVLTRNFILTAAHCVVSGASTLASGGVAIMG 117

  Fly   318 EHDL----STDTETGHVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICLPHTANL 378
            .|:.    ||..........|.|   ||.|:....|:|:|.:.|...:.||::|.||.||..::.
Mosquito   118 AHNRNIQESTQQRIRFATSGIRR---HPSYSSSTLRNDIATVRLNSPMTFTTRIQPIRLPGRSDT 179

  Fly   379 RQKSYVGYMPFVAGWGKTMEGGE-SAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCA 442
            ||  :.|:...|:|:|:|.:... ::.|:.....|:..|..|:..:       .:...::.|..:
Mosquito   180 RQ--FGGFTGTVSGFGRTSDASSATSAVVRFTTNPVMTNTDCIARW-------GSTVVNQHVCLS 235

  Fly   443 GVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGI--GCARPNVPGVYSSTQYFMDWIIQ 505
            |  :||:.:|.|||||||.:..  .|.::   |||||:|.  ||| ..:|.||:...:|:|||:.
Mosquito   236 G--AGGRSSCNGDSGGPLTVQS--GGTMQ---IGVVSFGSVNGCA-IGMPSVYARVTFFLDWIVA 292

  Fly   506 QVQDTP 511
            .....|
Mosquito   293 NSDFVP 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 77/256 (30%)
Tryp_SPc 261..503 CDD:238113 77/255 (30%)
AgaP_AGAP005690XP_001688708.1 Tryp_SPc 55..290 CDD:214473 77/256 (30%)
Tryp_SPc 56..290 CDD:238113 77/255 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.