DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and AgaP_AGAP005596

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_001688689.1 Gene:AgaP_AGAP005596 / 5666841 VectorBaseID:AGAP005596 Length:266 Species:Anopheles gambiae


Alignment Length:281 Identity:66/281 - (23%)
Similarity:101/281 - (35%) Gaps:58/281 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 SQIVPKNTDEIPRRLLNVEEGCGSTVGYFKKIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTL 294
            |.:||..........::.|... :|.||        ....|.:|::..:     ..:...|.|.|
Mosquito    24 SDVVPLQESTFVIEAMSTENRL-ATYGY--------APFPGQFPYLTFI-----ENNGVVCNGAL 74

  Fly   295 ITARHVLTAAH-CI-RQDLQFVRLGEHDLSTDTETGHVDINIARYV--SHPDYNRRNGRSDMAIL 355
            ||..::::.|. |: |..::..:.|...|:.:.......||.:...  .||       ..|:|:.
Mosquito    75 ITPNYIVSVARGCLNRSTIKTAQYGTAILAFNKNMWEQRINFSASAINLHP-------YEDIALA 132

  Fly   356 YLERNVEFTSKIAPICLPHTANLRQKSYVGYMPFVAGWGKTMEG---GESAQVLNELQIPIYDNK 417
            .|.........:.||.||..::.|  |||           .|||   ..:..|.|.    :..|.
Mosquito   133 RLNYPATLNKHVQPIRLPKLSDSR--SYV-----------DMEGTTVATNRYVRNR----VMSNA 180

  Fly   418 VCVQSYAKEKRYFSADQFDKAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGI 482
            .|    .||...|:|...|   :|.....||. .|....|.||.: |...|.:   |||:.::..
Mosquito   181 EC----TKEHPNFNATHVD---ICTDRYKGGA-FCSFFLGSPLTI-EDENGVI---LIGLANWIS 233

  Fly   483 GCARPNVPGVYSSTQYFMDWI 503
            .|.. |.|..|:....|.|||
Mosquito   234 SCDN-NYPTGYARILPFRDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 57/249 (23%)
Tryp_SPc 261..503 CDD:238113 57/248 (23%)
AgaP_AGAP005596XP_001688689.1 Tryp_SPc 54..256 CDD:304450 59/242 (24%)
Tryp_SPc 54..253 CDD:214473 57/240 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.