DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and si:dkey-33m11.8

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_693464.3 Gene:si:dkey-33m11.8 / 565078 ZFINID:ZDB-GENE-141215-49 Length:251 Species:Danio rerio


Alignment Length:256 Identity:91/256 - (35%)
Similarity:128/256 - (50%) Gaps:31/256 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 KKIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCIRQD-LQFVRLGEHDLS 322
            ::|:||:..:..:..:.|.:.|:    :...||||||..:.|::||||.|.. |..|.|.|||||
Zfish    22 QRIIGGQEVQPYSIKYQASVQYN----NYHYCGGTLIHPQWVVSAAHCWRPSYLIKVVLSEHDLS 82

  Fly   323 TDTETGHVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICLPHTANLRQKSYVGYM 387
            .......| .|:::.:.|..||.|...||:.:|.||:..|.::.|.|..||.:....|.   |.:
Zfish    83 KIEGFERV-FNVSKALVHYMYNYRTFDSDIMLLKLEKPAELSATIQPAVLPVSVPALQG---GTV 143

  Fly   388 PFVAGWGKTMEGGESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCAGVLSGGKDTC 452
            ..|:|||.|       ||.:....|:. ..|.||...:.:.|:.....|..| |||...||||:|
Zfish   144 CIVSGWGVT-------QVYSYYLSPVL-RAVDVQIIPQCQYYYYYRITDNMV-CAGSPLGGKDSC 199

  Fly   453 QGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCARPNVPGVYSSTQYF---MDWIIQQVQDT 510
            ||||||||:        ...|..|:||:||.||....||||:..:.:   |.|||.  .||
Zfish   200 QGDSGGPLI--------CNGYFEGIVSWGISCANAYFPGVYTKVRNYIPWMTWIID--NDT 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 86/246 (35%)
Tryp_SPc 261..503 CDD:238113 86/245 (35%)
si:dkey-33m11.8XP_693464.3 Tryp_SPc 23..241 CDD:214473 85/242 (35%)
Tryp_SPc 24..241 CDD:238113 85/241 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.