DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and KLK15

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_059979.2 Gene:KLK15 / 55554 HGNCID:20453 Length:256 Species:Homo sapiens


Alignment Length:258 Identity:75/258 - (29%)
Similarity:124/258 - (48%) Gaps:43/258 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 KIVGGEVSRKGAWPW-IALLGYDDPSGSPFKCGGTLITARHVLTAAHCIRQDLQFVRLGEHDLST 323
            |::.|:.....:.|| :||  |:   ...|.||.:||:...||:||||..:.:: ||||||:|. 
Human    21 KLLEGDECAPHSQPWQVAL--YE---RGRFNCGASLISPHWVLSAAHCQSRFMR-VRLGEHNLR- 78

  Fly   324 DTETGHVDI-NIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICLPHTANLRQKSYVGYM 387
             ...|...: ..:|.:.||.|..|:.|:|:.:|.|.:......::.|..||     .:..:.|..
Human    79 -KRDGPEQLRTTSRVIPHPRYEARSHRNDIMLLRLVQPARLNPQVRPAVLP-----TRCPHPGEA 137

  Fly   388 PFVAGWGKTM--EGGESAQVLNELQIP---------IYDNKVCVQSYAKEKRYFSADQFDKAVLC 441
            ..|:|||...  |.|.:....:::.:|         |..:..|.:||        ..:....::|
Human   138 CVVSGWGLVSHNEPGTAGSPRSQVSLPDTLHCANISIISDTSCDKSY--------PGRLTNTMVC 194

  Fly   442 AGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYG-IGCARPNVPGVYSSTQYFMDWI 503
            ||....|.::|:|||||||:.     |.:   |.|:||:| :.|.....||||:...::::||
Human   195 AGAEGRGAESCEGDSGGPLVC-----GGI---LQGIVSWGDVPCDNTTKPGVYTKVCHYLEWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 73/256 (29%)
Tryp_SPc 261..503 CDD:238113 72/255 (28%)
KLK15NP_059979.2 Tryp_SPc 25..249 CDD:214473 72/252 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.