DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and ctrb.3

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001017724.1 Gene:ctrb.3 / 550419 ZFINID:ZDB-GENE-050417-229 Length:265 Species:Danio rerio


Alignment Length:264 Identity:80/264 - (30%)
Similarity:131/264 - (49%) Gaps:29/264 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 GCG-----STVGYFKKIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCIRQ 309
            |||     ..|..:.:||.||.:...:|||...|  .|.:|..| |||:||....|:|||||..:
Zfish    18 GCGVPAIPPVVSGYARIVNGEEAVPHSWPWQVSL--QDFTGFHF-CGGSLINEFWVVTAAHCSVR 79

  Fly   310 DLQFVRLGEHDL-STDTETGHVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICLP 373
            ....|.||||:. .::|:.....:.:::..:||.||.....:|:|::.|.......:.::|:||.
Zfish    80 TSHRVILGEHNKGKSNTQEDIQTMKVSKVFTHPQYNSNTIENDIALVKLTAPASLNAHVSPVCLA 144

  Fly   374 HTANLRQKSYVGYMPFV-AGWGKTMEGG-ESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFD 436
            ..::    ::...|..| :|||.|.... .:...|.::.:|:..|:.|       |.::.::..|
Zfish   145 EASD----NFASGMTCVTSGWGVTRYNALFTPDELQQVALPLLSNEDC-------KNHWGSNIRD 198

  Fly   437 KAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCARPNVPGVYSSTQYFMD 501
             .::|||  :.|..:|.|||||||:.    |....:.|:|:||:|.....|.:||||.......|
Zfish   199 -TMICAG--AAGASSCMGDSGGPLVC----QKDNIWTLVGIVSWGSSRCDPTMPGVYGRVTELRD 256

  Fly   502 WIIQ 505
            |:.|
Zfish   257 WVDQ 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 74/245 (30%)
Tryp_SPc 261..503 CDD:238113 74/244 (30%)
ctrb.3NP_001017724.1 Tryp_SPc 33..258 CDD:214473 74/245 (30%)
Tryp_SPc 34..261 CDD:238113 76/248 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.