DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and Tpsab1

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_062195.2 Gene:Tpsab1 / 54271 RGDID:3066 Length:310 Species:Rattus norvegicus


Alignment Length:332 Identity:102/332 - (30%)
Similarity:154/332 - (46%) Gaps:67/332 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 ATFANFLRASNAVCQNKGTQVCCPTGQGITNTTPAPSQIVPKNTDEIPRRLLNVEEGCGSTVGYF 258
            |..:|..|.::.|...|...:..|....:.:.  |||..:|:             ||        
  Rat    24 ALTSNRARTTHCVRMLKLLLLTLPLLSSLVHA--APSLAMPR-------------EG-------- 65

  Fly   259 KKIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCI----------RQDLQF 313
              ||||:.:....|||...|..:|.....| |||:||..:.|||||||:          |..|:.
  Rat    66 --IVGGQEASGNKWPWQVSLRVNDTYWMHF-CGGSLIHPQWVLTAAHCVGPNKADPNKLRVQLRK 127

  Fly   314 VRLGEHDLSTDTETGHVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICLPHTANL 378
            ..|..||        |: :.:::.:||||:......:|:|:|.|...|..||.:..:.||..:..
  Rat   128 QYLYYHD--------HL-LTVSQIISHPDFYIAQDGADIALLKLTNPVNITSNVHTVSLPPASET 183

  Fly   379 RQKSYVGYMPFVAGWGKTMEGGESAQ---VLNELQIPIYDNKVCVQSYAK-----EKRYFSADQF 435
            ...   |.:.:|.||| .:....|..   .|.|:|:||.:|::|...|.|     :..:...|. 
  Rat   184 FPS---GTLCWVTGWG-NINNDVSLPPPFPLEEVQVPIVENRLCDLKYHKGLNTGDNVHIVRDD- 243

  Fly   436 DKAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCARPNVPGVYSSTQYFM 500
               :||||  :.|.|:|||||||||:.    :.:..:...||||:|.|||:||.||:|:...|::
  Rat   244 ---MLCAG--NEGHDSCQGDSGGPLVC----KVEDTWLQAGVVSWGEGCAQPNRPGIYTRVTYYL 299

  Fly   501 DWIIQQV 507
            |||.:.|
  Rat   300 DWIYRYV 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 5/21 (24%)
Tryp_SPc 260..503 CDD:214473 87/260 (33%)
Tryp_SPc 261..503 CDD:238113 87/259 (34%)
Tpsab1NP_062195.2 Tryp_SPc 66..302 CDD:214473 87/259 (34%)
Tryp_SPc 66..302 CDD:238113 87/259 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.