DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and prss27

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_031749235.1 Gene:prss27 / 496619 XenbaseID:XB-GENE-5744470 Length:724 Species:Xenopus tropicalis


Alignment Length:302 Identity:97/302 - (32%)
Similarity:144/302 - (47%) Gaps:36/302 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 PTGQGITNTTPAPSQIVPKNTDEIPRRLLNVEEGCGSTVGYFKKIVGGEVSRKGAWPWIALLGYD 281
            |..|.:...||....|.|..||            ||..: ...:|:||:.:::|.|||  .:.:.
 Frog     3 PLLQALLLLTPGLLGITPGATD------------CGIPL-VSSRIMGGQSAQEGQWPW--QVSFR 52

  Fly   282 DPSGSPFKCGGTLITARHVLTAAHCIRQDLQ----FVRLGEHDLSTDTETGH-VDINIARYVSHP 341
            : :|..| ||||||:.::|::||||......    ...||.:.:  |...|: |.|.:....::|
 Frog    53 N-NGGHF-CGGTLISKQYVISAAHCFPSSSSASSVTAVLGAYMI--DQPDGNQVAIPVQSATNYP 113

  Fly   342 DYNRRNGRSDMAILYLERNVEFTSKIAPICLP-HTANLRQKSYVGYMPFVAGWGKTMEGGE--SA 403
            .|.......|::::.|...|.||:.|.|:||| .|....    .|...:|.|||.......  |.
 Frog   114 SYVNEGDSGDISLVQLASPVTFTNYILPVCLPADTVTFP----TGLQCWVTGWGNIASDVSLVSP 174

  Fly   404 QVLNELQIPIYDNKVCVQSYAKEKRY-FSADQFDKAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQ 467
            ..|.|:.:|:.|...|...|.....| .|:......::|||.::||||:|||||||||:...  .
 Frog   175 MTLQEVAVPLIDANECNALYQTPNSYGTSSISVHSDMICAGFINGGKDSCQGDSGGPLVCSS--S 237

  Fly   468 GQLRFYLIGVVSYGIGCARPNVPGVYSSTQYFMDWIIQQVQD 509
            ||  ::|.||||:|.||.:...||||:....:.|||:....|
 Frog   238 GQ--WFLAGVVSFGEGCGQAYRPGVYTLMPSYTDWIVSYASD 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 84/251 (33%)
Tryp_SPc 261..503 CDD:238113 84/250 (34%)
prss27XP_031749235.1 Tryp_SPc 34..271 CDD:238113 84/250 (34%)
Tryp_SPc 420..659 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.