DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and zgc:92590

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001007055.1 Gene:zgc:92590 / 474322 ZFINID:ZDB-GENE-041024-15 Length:247 Species:Danio rerio


Alignment Length:250 Identity:83/250 - (33%)
Similarity:120/250 - (48%) Gaps:27/250 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 KIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHC-IRQDLQFVRLGEHDLST 323
            ||:||......:.||...|.||  :|..: ||.:||..|..::|||| :..:...|.||||:::.
Zfish    20 KIIGGYECSPNSQPWQIYLTYD--NGQRW-CGASLINDRWAVSAAHCYLVANRLTVHLGEHNVAV 81

  Fly   324 DTETGHVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICLPHTANLRQKSYVGYMP 388
            :..| ...|...:.:.||.||.....:|..::.|:....|...:.|:  |.|.:.   |..|...
Zfish    82 EEGT-EQRIKAEKVIPHPKYNDYTLDNDFMLIKLKEPAVFNQYVQPV--PLTTSC---SSEGEQC 140

  Fly   389 FVAGWGKTMEGG-ESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCAGVLSGGKDTC 452
            .|:|||..:..| ....||..|.:|:.....|..:|..        |..|.:.|||.:.||||.|
Zfish   141 LVSGWGNLINTGVVYPDVLQCLNLPVLTRAQCEGAYGW--------QITKNMFCAGFMEGGKDAC 197

  Fly   453 QGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCARPNVPGVYSSTQYFMDWIIQQV 507
            |||||||::.    .|:||    ||||:|.|||....||||:....:.||:...:
Zfish   198 QGDSGGPVIC----NGELR----GVVSWGYGCADSGYPGVYTEVCRYTDWVASTI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 82/244 (34%)
Tryp_SPc 261..503 CDD:238113 81/243 (33%)
zgc:92590NP_001007055.1 Tryp_SPc 20..240 CDD:214473 82/244 (34%)
Tryp_SPc 21..243 CDD:238113 82/246 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.