DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and CG9737

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:415 Identity:126/415 - (30%)
Similarity:181/415 - (43%) Gaps:99/415 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 DTKPGNCVEIKECASLLNELRSRSQDATFANFLR-----ASNAVCQNKGTQ---VCCP-TGQGIT 223
            :||.|.|:|:..|.:.|....:.:..|...|||:     ....|.:.:|:.   |||| .||...
  Fly    33 ETKRGVCLEVSRCKAYLQVRNATNLPAEKVNFLKKVQCEVEQQVSEAQGSYESLVCCPANGQDYL 97

  Fly   224 NTTPAPSQIVPK---------NTDEIPRRLLNVEEG--------CGSTVGYFKKIVGGEVSRKGA 271
            ......|:...:         ...::.||:..||..        ||..|  ..:|.|||::....
  Fly    98 FPVLQFSKFEYRRFLDVTARFKRKKLKRRIQTVEPSSGFNLLNECGKQV--TNRIYGGEIAELDE 160

  Fly   272 WPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCI-------RQDLQFVRLGEHDLSTDTE--- 326
            :||:|||.|   :.:.:.|.|.||..||:||||||:       ||.|:.|||||.::.|:.:   
  Fly   161 FPWLALLVY---NSNDYGCSGALIDDRHILTAAHCVQGEGVRDRQGLKHVRLGEFNVKTEPDCIE 222

  Fly   327 --------TGHVDINIARYVSHPDYNRRNG--RSDMAILYLERNVEFTSKIAPICLPHTA---NL 378
                    ...:||...:...||:|...:.  .:|:||:.|:..|.||..:.|||||:.:   .|
  Fly   223 EPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFTHFVMPICLPNKSEPLTL 287

  Fly   379 RQKSYVGYMPFVAGWGKTMEGGESAQVLN------------ELQIPIYDNKVCVQSYAKEKRYFS 431
            .:    |.|..|:|||:|       .:.|            :|:||...|:.|    .|....|.
  Fly   288 AE----GQMFSVSGWGRT-------DLFNKYFINIHSPIKLKLRIPYVSNENC----TKILEGFG 337

  Fly   432 ADQFDKAVLCAGVLSG--GKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGI-GCARPNVPGVY 493
            .....|.: |||   |  .||||.||||||||..:  :...|:...||||||. .|.....|.||
  Fly   338 VRLGPKQI-CAG---GEFAKDTCAGDSGGPLMYFD--RQHSRWVAYGVVSYGFTQCGMAGKPAVY 396

  Fly   494 SSTQYFMDWI---------IQQVQD 509
            ::...:.|||         .||.||
  Fly   397 TNVAEYTDWIDSVVQQRKKSQQTQD 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 14/55 (25%)
Tryp_SPc 260..503 CDD:214473 93/280 (33%)
Tryp_SPc 261..503 CDD:238113 93/279 (33%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855 14/55 (25%)
Tryp_SPc 149..406 CDD:214473 93/280 (33%)
Tryp_SPc 150..409 CDD:238113 95/282 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.920

Return to query results.
Submit another query.