DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and Tmprss9

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_006513905.2 Gene:Tmprss9 / 432478 MGIID:3612246 Length:1342 Species:Mus musculus


Alignment Length:406 Identity:117/406 - (28%)
Similarity:161/406 - (39%) Gaps:91/406 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 RTTTTTTTTTPAPIPDTSAAPLIEPRGTVCRGPDTKPGNCVEIKECASLLNELRSRSQDATFANF 199
            |..|::|...|:..|.|:||.||.|..|..                       |..:..||....
Mouse   997 RPHTSSTRLIPSEPPKTTAAGLIIPEATTS-----------------------RLATPRATIRVT 1038

  Fly   200 LRASNAVCQNKGTQVCCPTGQGITNTTPAPSQIVPKNTDEIPRRLLNVEEGCG-STVGYFKKIVG 263
            .|..|.....:.|     |.:|.|....||...:..:..:           || :..|...:|||
Mouse  1039 TRPLNTTLSARST-----TTRGQTAAPSAPGTTIHSHLPD-----------CGLAPPGALTRIVG 1087

  Fly   264 GEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCI---RQDLQFVR-LGEHDLSTD 324
            |..:..|.|||...|..   .....:||..|:..|.:|:||||.   ...:|:.. ||...||: 
Mouse  1088 GSAASLGEWPWQVSLWL---RRREHRCGAVLVAERWLLSAAHCFDIYGDPMQWAAFLGTPFLSS- 1148

  Fly   325 TETGHVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICLPHTANLRQKSYVGYMPF 389
            || |.:: .:||...||.||......|:|:|.|...|..:..:.|||||..|    :...|....
Mouse  1149 TE-GQLE-RVARIYRHPFYNIYTLDYDVALLELAGPVRRSRLVRPICLPGPA----RPPDGARCV 1207

  Fly   390 VAGWGKTMEG--------------------------GESAQVLNELQIPIYDNKVCVQSYAKEKR 428
            :.|||...||                          |..|:.|.:..:.:...:.|        |
Mouse  1208 ITGWGSLREGGIHACVRRSPGGVGDTPHLHLSPDPTGSMARQLQKAAVRVLSEQTC--------R 1264

  Fly   429 YFSADQFDKAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCARPNVPGVY 493
            .|...|....:||||...||.|:|.||:||||...|| .||  :.|.||.|:|.||.||:.||||
Mouse  1265 RFYPVQISSRMLCAGFPQGGVDSCSGDAGGPLACREP-SGQ--WVLTGVTSWGYGCGRPHFPGVY 1326

  Fly   494 SSTQYFMDWIIQQVQD 509
            :.....:.||.|.:|:
Mouse  1327 TRVAAVLGWIGQNIQE 1342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 6/51 (12%)
Tryp_SPc 260..503 CDD:214473 87/272 (32%)
Tryp_SPc 261..503 CDD:238113 87/271 (32%)
Tmprss9XP_006513905.2 SEA 285..365 CDD:366610
LDLa 407..442 CDD:238060
Tryp_SPc 455..684 CDD:214473
Tryp_SPc 756..984 CDD:214473
Tryp_SPc 1085..1336 CDD:238113 87/271 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.