DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and CG16710

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:381 Identity:118/381 - (30%)
Similarity:176/381 - (46%) Gaps:103/381 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 CVEIKECASLLNELRSRSQDATFANFLRASNAVCQN-------KGTQ------VCCPT-GQGITN 224
            |:.:..|.|||..|:..       |...|..||.::       ||.:      :|||. |..:.|
  Fly    36 CISLARCTSLLPFLKPH-------NMTPAEKAVFEDRYCGYGPKGQELLDRVLICCPNMGHILPN 93

  Fly   225 TTPAPSQIVPKNTDEIPRRLLNVEEGCGSTVGYFKKIVGGEVSRKGAWPWIALLGYDDPSGSPF- 288
            |     ||                  ||..:..: :|.|||.::....||:||:.|...|.|.: 
  Fly    94 T-----QI------------------CGPIMPAY-RIFGGEETQPNELPWMALILYAHRSRSVWN 134

  Fly   289 -----KCGGTLITARHVLTAAHCIR---QDLQFVRLGEHDLSTDTE------------TGHVDIN 333
                 :|.|:|||.|:|||||||:|   .||:.||||||::.::.:            ..|::|:
  Fly   135 ERLVSRCAGSLITNRYVLTAAHCLRITGLDLRRVRLGEHNILSNPDCVTHINGREHCAPEHLEID 199

  Fly   334 IARYVSHPDYNRRNGR--SDMAILYLERNVEFTSKIAPICLPHTANLRQKSYVGYMPFVAGWGKT 396
            :...:.|..|.....|  :|:|:|.|:..|.:|::|.|||:.........|:..:...:||||.:
  Fly   200 VDLSIKHRHYMVFEERPYNDIALLRLKFPVRYTAQIKPICVQLDYIFSNPSFSNHKLQIAGWGLS 264

  Fly   397 MEGGESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQ---------FDKAV-LCAGVLSGGKDT 451
            .:.|             |.| |.:|:|...:   :||:         .||.. :|||.| ||.||
  Fly   265 HKQG-------------YSN-VLLQAYVNGR---NADECSLSEPSLGLDKETHICAGNL-GGNDT 311

  Fly   452 CQGDSGGPLM-LPEPYQGQLRF-YLIGVVSYGIG-CARPNVPGVYSSTQYFMDWII 504
            |:|||||||| :.|  :|...| ||.|:.|||.. |...  |..|:.|..|::||:
  Fly   312 CKGDSGGPLMAIME--RGDEEFVYLAGITSYGYSQCGYG--PAAYTKTSKFVEWIL 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 12/54 (22%)
Tryp_SPc 260..503 CDD:214473 94/278 (34%)
Tryp_SPc 261..503 CDD:238113 94/277 (34%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855 12/54 (22%)
Tryp_SPc 105..362 CDD:214473 94/278 (34%)
Tryp_SPc 106..362 CDD:238113 94/277 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.