DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and CG31199

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:270 Identity:66/270 - (24%)
Similarity:105/270 - (38%) Gaps:75/270 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 WIALLGYDDPSGSPFK-------CGGTLITARHVLTAAHCIRQ-----DLQFVRLGEHDLSTDT- 325
            |:|.:.|    |..|:       |.|.|::.|.||..|||..|     :...|.||.|:.|... 
  Fly    52 WVARIVY----GKGFEGKIRDNGCLGVLVSKRTVLAPAHCFVQYNGVAEAFSVHLGVHNKSAPVG 112

  Fly   326 ----ET-GHV-----DINIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICLPHTANLRQ 380
                || |:.     :|.:|....||||:.|..::.:|:|.|:|:.:....:.|||:| ..:|..
  Fly   113 VRVCETDGYCVRPSQEIKLAEIAIHPDYDSRTLKNSLAVLTLQRDAKIYPNVMPICMP-PPSLLN 176

  Fly   381 KSYVGYMPFVAG-----------WGKTMEGGESAQVLNELQIPIYDNKVCVQSYAKEK-RYFSAD 433
            ::.|.....|||           |..|:..|.....:..|...  .|.||  .|.|:. .|:   
  Fly   177 ETLVAQTFVVAGLRVFEDFRLKTWVNTLSRGFCQSKVKTLVTS--SNTVC--GYHKQPVAYY--- 234

  Fly   434 QFDKAVLCAGVLSGGKDTCQGDSGGPLM-LPEPYQGQLRFYLIGVVSYGIGCARPN--VPGVYSS 495
                                  .|.||: |.:.......:||:|::   |.....|  :...:.:
  Fly   235 ----------------------LGAPLVGLQKKGHVTQNYYLVGIM---IDWRWENNRIMSSFLA 274

  Fly   496 TQYFMDWIIQ 505
            .:.:||:|.|
  Fly   275 IRNYMDFIRQ 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 64/266 (24%)
Tryp_SPc 261..503 CDD:238113 64/266 (24%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 59/238 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.