DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and CG7432

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_650825.2 Gene:CG7432 / 42347 FlyBaseID:FBgn0038727 Length:721 Species:Drosophila melanogaster


Alignment Length:442 Identity:136/442 - (30%)
Similarity:200/442 - (45%) Gaps:76/442 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 IPTPRTTTTTTTTTPAPI---PDTSAAPLIEPRGT------VCRGPDTKPGNCVEIKECASLLNE 186
            |||...||||:|||.|||   |....|...:..||      .|:.|..:.|.|.::..|.:||..
  Fly   293 IPTTPRTTTTSTTTEAPITLTPLDQLAEASDEAGTGKDVENYCKTPSGRRGRCEDLSSCPALLLN 357

  Fly   187 LRSRSQDATFANF-------------------------LRASNAVCQNKGTQ------------- 213
            |.|..:...|.:.                         .|.:......|.||             
  Fly   358 LSSLRESLCFKSLYVPGVCCPISSSSTVLTTQKPLRLTTRPTTTTSTTKATQPTKKSTVRPTTRP 422

  Fly   214 ----VCCPTGQGITNTTPAPSQI--VPKNTDEIPRRLLNVEEGCGSTVGYFKKIVGGEVSRKGAW 272
                |..|..:..|.||...:::  .|:..|||...:::.:| ||.......:||||..:..|.|
  Fly   423 TSGLVLIPQKKPPTTTTTTTTEVPLEPEGLDEIGNNIVDPDE-CGQQEYSTGRIVGGVEAPNGQW 486

  Fly   273 PWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCIRQDLQ--------FVRLGEHDLSTDTE-TG 328
            ||:|.:....|..:.|.|||:||..:::||||||.|...|        .||||:.|||||.| :.
  Fly   487 PWMAAIFLHGPKRTEFWCGGSLIGTKYILTAAHCTRDSRQKPFAARQFTVRLGDIDLSTDAEPSD 551

  Fly   329 HVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICLPHTANLRQKSYV-GYMPFVAG 392
            .|...:....:|..::|....:|:|||.|::.|..:..:.|:|||....:..|..: |....|.|
  Fly   552 PVTFAVKEVRTHERFSRIGFYNDIAILVLDKPVRKSKYVIPVCLPKGIRMPPKERLPGRRATVVG 616

  Fly   393 WGKTMEGGESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCAGVLSGGKDTCQGDSG 457
            ||.|..||:.:....:.::||:.|:.|.:||.:        ..::..:|||...||.|.||||||
  Fly   617 WGTTYYGGKESTSQRQAELPIWRNEDCDRSYFQ--------PINENFICAGYSDGGVDACQGDSG 673

  Fly   458 GPLMLPEPYQGQLRFYLIGVVSYGIGCARPNVPGVYSSTQYFMDWIIQQVQD 509
            ||||:    :....:..:||||:|..|..|..||||:....::|||....:|
  Fly   674 GPLMM----RYDSHWVQLGVVSFGNKCGEPGYPGVYTRVTEYLDWIRDHTRD 721

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 15/93 (16%)
Tryp_SPc 260..503 CDD:214473 90/252 (36%)
Tryp_SPc 261..503 CDD:238113 90/251 (36%)
CG7432NP_650825.2 CLIP 335..378 CDD:197829 10/42 (24%)
Tryp_SPc 474..715 CDD:214473 90/252 (36%)
Tryp_SPc 475..718 CDD:238113 92/254 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.