DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and ea

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster


Alignment Length:374 Identity:117/374 - (31%)
Similarity:178/374 - (47%) Gaps:48/374 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 CRGPDTKPGNCVEIKECASLLNELRSRSQDATFANFLRASNAVCQNKGTQVCCPT--GQGITNTT 226
            |..|:.:...|:.:::|..|...|.:.....|...:|..|.....|....:|||.  .:..:.||
  Fly    37 CITPNRERALCIHLEDCKYLYGLLTTTPLRDTDRLYLSRSQCGYTNGKVLICCPDRYRESSSETT 101

  Fly   227 PAPSQIVPKNTDEIPRRLLNVEEGCGSTVGYFKKIVGGEVSRKGAWPWIALLGYDDPSGSP-FKC 290
            |.|...|..|:      ||.:...||:.:.  .:|.||..::...:||:||:.|....|.. ..|
  Fly   102 PPPKPNVTSNS------LLPLPGQCGNILS--NRIYGGMKTKIDEFPWMALIEYTKSQGKKGHHC 158

  Fly   291 GGTLITARHVLTAAHCIRQD-------LQFVRLGEHDLST------------DTETGHVDINIAR 336
            ||:||:.|:|:||:||:...       |..|||||.|.:|            |....|:|:.:.|
  Fly   159 GGSLISTRYVITASHCVNGKALPTDWRLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVER 223

  Fly   337 YVSHPDY--NRRNGRSDMAILYLERNVEFTSKIAPICLPHTANLRQKSYVGYMPFVAGWGKTMEG 399
            .:.||||  ..:|..:|:|:|.|.:.||:|..:.|||||...|||..::.|....|||||||.:.
  Fly   224 TIPHPDYIPASKNQVNDIALLRLAQQVEYTDFVRPICLPLDVNLRSATFDGITMDVAGWGKTEQL 288

  Fly   400 GESAQVLNELQIPIYDNKVCVQSYAKEK---RYFSAD-QFDKAVLCAGVLSGGKDTCQGDSGGPL 460
            ..|...|          |..|:.:..::   .|.|.| ..:...:|||. ..|.|:|:|||||||
  Fly   289 SASNLKL----------KAAVEGFRMDECQNVYSSQDILLEDTQMCAGG-KEGVDSCRGDSGGPL 342

  Fly   461 MLPEPYQGQLRFYLIGVVSYG-IGCARPNVPGVYSSTQYFMDWIIQQVQ 508
            :..:..:....::|.||||:| ..|.....||||:....::|||...::
  Fly   343 IGLDTNKVNTYYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWIQNTIE 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 10/51 (20%)
Tryp_SPc 260..503 CDD:214473 92/269 (34%)
Tryp_SPc 261..503 CDD:238113 92/268 (34%)
eaNP_524362.2 CLIP 37..89 CDD:288855 10/51 (20%)
Tryp_SPc 127..386 CDD:214473 92/269 (34%)
Tryp_SPc 128..389 CDD:238113 94/271 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.920

Return to query results.
Submit another query.