DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and CG3505

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:388 Identity:114/388 - (29%)
Similarity:174/388 - (44%) Gaps:83/388 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 APIPDTSAAPLIEPRGTVCRGPDTKPGNCVEIKECASLLNELRSRSQDATFANFLRASNAVCQNK 210
            |.:|..:....| |.|.|       .|:|:.|:||...:..|.|.:...:..|.||.:....:..
  Fly    20 AQLPPINCVAKI-PSGRV-------TGHCISIRECDYFMRILLSGNLSQSDRNLLRDNQCGVRGN 76

  Fly   211 GTQVCCPTGQGITNTTPAPSQIVPKNTDEIPRRLLNVEEGCGSTVGYFKKIVGGEVSRKGAWPWI 275
            ..|||||:..|:...|   ..::|.:..::..:..|..:                 :|...:||:
  Fly    77 DVQVCCPSTAGLGALT---HPLLPSDCGKVRWQRSNDTD-----------------TRIREFPWL 121

  Fly   276 ALLGYDDPSGSPFK---CGGTLITARHVLTAAHCIRQ----DLQF--VRLGEHDLST-------- 323
            ||:.|  ..|:..|   |||.||:.|:|||||||:.|    :||.  |||||.|.||        
  Fly   122 ALIEY--TRGNQEKIHACGGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEWDTSTNPDCQYHE 184

  Fly   324 -----DTETGHVDINIARYVSHPDYNR--RNGRSDMAILYLERNVEFTSKIAPICLPHTANLRQK 381
                 |....:.||.|...:.||.|||  |...:|:|::.|....:....:.|||||: ..||..
  Fly   185 DSKVADCAPPYQDIAIEELLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPICLPN-KQLRAD 248

  Fly   382 SYVGYMPFVAGWGKTMEGGESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCAGVLS 446
            .....:..||||     ...|:|.:.:..:.|...:.|.:.||.::....|.:     ||.  |:
  Fly   249 ELEDLVTEVAGW-----QASSSQRMRKGYVTISSIEECQRKYASQQLRIQASK-----LCG--LT 301

  Fly   447 GGKDTCQGDSGGPLMLPEPYQGQLRF----YLI-GVVSYG-IGCARPNVPGVYSSTQYFMDWI 503
            ..:: |.|::||||||         |    ||: |:||:| :.|..|:.|.||:....::|||
  Fly   302 NSQE-CYGNAGGPLML---------FKNDGYLLGGLVSFGPVPCPNPDWPDVYTRVASYIDWI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 12/51 (24%)
Tryp_SPc 260..503 CDD:214473 87/272 (32%)
Tryp_SPc 261..503 CDD:238113 87/271 (32%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855 16/59 (27%)
Tryp_SPc 111..356 CDD:238113 89/286 (31%)
Tryp_SPc 111..354 CDD:214473 87/284 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.