DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and CG8870

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:376 Identity:112/376 - (29%)
Similarity:170/376 - (45%) Gaps:97/376 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 DTKPGNCVEIKECASLLNELRSRSQDATFANFLRASNAVCQNKGT-QVCCPTGQGITNTTPAPSQ 231
            ||:   ||.:.:|.      |:|:    ..|..|.:....:..|| :||||..:          .
  Fly    29 DTE---CVNLDKCP------RTRA----VMNSSRKNIIGLRRCGTNKVCCPKWE----------T 70

  Fly   232 IVPKNTDEIPRRLLNVEEGCGSTVGYFKKIVGGEVSRKGAWPWIALLGYDDPSG-----SPFKCG 291
            .:|.:|             ||.:   .:|...|::.....:||:|:|.|.:.:.     .| |||
  Fly    71 YLPHDT-------------CGQS---RRKPTKGKIPALNEFPWMAMLLYGNKNNLSQKLVP-KCG 118

  Fly   292 GTLITARHVLTAAHCIRQD-------LQFVRLGEHDLSTDTETG-----------HVDINIARYV 338
            |:||...:|||||||:...       |:.||||||:.||:.:..           :::|.:.:.:
  Fly   119 GSLINNWYVLTAAHCVEYPFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQII 183

  Fly   339 SHPDYNRRNGR---SDMAILYLERNVEFTSKIAPICLPHTANLRQKSYVGYMPFVA-GWGKTMEG 399
            :|..:||  ||   :|:|::.|:..|.:|..|.|||||..    ||.......|.| || ..|..
  Fly   184 THEQFNR--GRRLINDIALVRLKFPVRYTRAIQPICLPRA----QKLAAHKRKFQASGW-PDMGQ 241

  Fly   400 GESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFD-KAVLCAGVLSGGKDTCQGDSGGPLMLP 463
            |.:::||....|......||..:|          .|: .:.:|||.|. |.||..|||||||| .
  Fly   242 GIASEVLLRSFIAERHPDVCKSNY----------DFNLGSQICAGGLD-GNDTSPGDSGGPLM-E 294

  Fly   464 EPYQGQLRF-YLIGVVSYGIGCARPNV-----PGVYSSTQYFMDWIIQQVQ 508
            ...:|::.. |..|::|||   .:|.|     |..|:.|.||.:||..::|
  Fly   295 TVIRGKVTLTYAAGIISYG---QKPCVLKTCKPAFYTKTSYFFEWIKSKLQ 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 12/48 (25%)
Tryp_SPc 260..503 CDD:214473 90/276 (33%)
Tryp_SPc 261..503 CDD:238113 89/275 (32%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 90/269 (33%)
Tryp_SPc 93..337 CDD:214473 88/266 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.