DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and CG16749

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:324 Identity:89/324 - (27%)
Similarity:140/324 - (43%) Gaps:77/324 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 SRSQDATFANFLRASNAVCQNKGTQVCCPTGQGITNTTPAPSQIVPKNTDEIPRRLLNVEEGCGS 253
            ||:||...|.|...:.|               ||::..|...::|               .|..|
  Fly     2 SRNQDLCLAVFALLTTA---------------GISHGAPQMGRVV---------------NGTDS 36

  Fly   254 TVGYFKKIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCI----RQDLQFV 314
            :|..:..:    :|.:|:            ||| ..|||::|:.:.|:|||||.    ..||.. 
  Fly    37 SVEKYPFV----ISMRGS------------SGS-HSCGGSIISKQFVMTAAHCTDGRKASDLSV- 83

  Fly   315 RLGEHDLSTDTETGHVDINIARYVSHPDYNRRNG-RSDMAILYLERNVEFTS-KIAPICLPHTAN 377
               ::.::....||...:.:.:.:.|.|||..|. .:|:::|.:|...||.. .:||:.||..|.
  Fly    84 ---QYGVTKINATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPELAF 145

  Fly   378 LRQKSYVGYMPFVAGWGKTMEGGESAQVLNELQIPIYDNKVCVQSYA--KEKRYFSADQFDKAVL 440
            ...::..|....:.|||....||.....|.|:::.:|.::.|.:.:.  .:.||.         :
  Fly   146 ATPQTDAGGEGVLIGWGLNATGGYIQSTLQEVELKVYSDEECTERHGGRTDPRYH---------I 201

  Fly   441 CAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGI-GCARPNVPGVYSSTQYFMDWI 503
            |.||..|||..|.|||||||:    |.||    .:|:||:.| .|.....||||.....::|||
  Fly   202 CGGVDEGGKGQCSGDSGGPLI----YNGQ----QVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 7/26 (27%)
Tryp_SPc 260..503 CDD:214473 73/251 (29%)
Tryp_SPc 261..503 CDD:238113 73/250 (29%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 77/280 (28%)
Tryp_SPc 30..259 CDD:238113 79/281 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.