DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and Mcpt1l3

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_038949770.1 Gene:Mcpt1l3 / 408209 RGDID:1302933 Length:270 Species:Rattus norvegicus


Alignment Length:247 Identity:74/247 - (29%)
Similarity:117/247 - (47%) Gaps:26/247 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 KKIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCIRQDLQFVRLGEHDLST 323
            ::||||..|...:.|::|.|......|....|||.||:.:.|||||||..:::. |.||.||:| 
  Rat    40 EEIVGGVESIPHSRPYMAHLKITTEKGYVTFCGGFLISRQFVLTAAHCNGREIT-VTLGAHDVS- 102

  Fly   324 DTETGHVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICLPHTANLRQKSYVGYMP 388
            ..|:....:.:.:.:.|.:||..:...|:.:|.||:.||.|..:..:.||..::....   |.|.
  Rat   103 KRESTQQKLKVEKQIIHKNYNFFSNIHDIMLLKLEKQVELTPAVDVVPLPSPSDFIDP---GTMC 164

  Fly   389 FVAGWGKT--MEGGESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCAGVLSGGKDT 451
            ..||||:|  .:.......|.|:::.|.|.:.|        :.|| |......:|.|.....:..
  Rat   165 QAAGWGQTGVTDPTSYTYTLREVELRIMDVEAC--------KIFS-DYDYNFQMCVGSPGRMRSP 220

  Fly   452 CQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCARPNVPGVYSSTQYFMDWI 503
            .:|||||||:......        |:||:|...|:|  |.|::....::.||
  Rat   221 YEGDSGGPLLCAGVAH--------GIVSHGREDAKP--PAVFTRISPYVPWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 72/244 (30%)
Tryp_SPc 261..503 CDD:238113 72/243 (30%)
Mcpt1l3XP_038949770.1 Tryp_SPc 42..263 CDD:238113 74/245 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.