DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and ela2

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001132936.1 Gene:ela2 / 403061 ZFINID:ZDB-GENE-041117-1 Length:266 Species:Danio rerio


Alignment Length:274 Identity:98/274 - (35%)
Similarity:139/274 - (50%) Gaps:49/274 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 GCGSTVGYFK----KIVGGEVSRKGAWPWIALLGYDDPSGSPF--KCGGTLITARHVLTAAHCIR 308
            |||...  :|    ::|||...|..:|||.|.|.|.  |||.|  .||||||..:.||||||||.
Zfish    15 GCGQPT--YKPIDSRVVGGSDVRPNSWPWQASLQYQ--SGSSFYHTCGGTLIDKQWVLTAAHCIS 75

  Fly   309 QDLQFVRLGEHDLSTDTETGHVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICLP 373
            .....|.||:|:|...:|:|...|:.||.:.|.:::..|.|:|:|::.|...|.||.||:|.|||
Zfish    76 SRTYRVLLGKHNLPLSSESGSQAISPARIIVHENWDSYNIRNDIALIKLSTPVTFTDKISPACLP 140

  Fly   374 HTANLRQKSYVGYMP-----FVAGWGKTMEGGESAQVLNELQIPIYDNKVCVQSYAKEKRYFSAD 433
            .:.::        :|     :|.|||:...||..|.:|.:..:||.|...|.:|          |
Zfish   141 DSGSI--------LPHNSPCYVTGWGRLWTGGPIADILQQALLPIVDQATCTKS----------D 187

  Fly   434 QFDKAV----LCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLR---FYLIGVVSYG--IGCARPNV 489
            .:...|    :|||. .|...:|.|||||||      ..|.|   :.:.|:||:|  :||..|..
Zfish   188 WWGNLVTDLMVCAGG-DGVVSSCNGDSGGPL------NCQRRDGTWDVHGIVSFGSSLGCNYPKK 245

  Fly   490 PGVYSSTQYFMDWI 503
            |.|::....::.||
Zfish   246 PSVFTRVSGYIPWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 92/258 (36%)
Tryp_SPc 261..503 CDD:238113 92/257 (36%)
ela2NP_001132936.1 Tryp_SPc 27..259 CDD:214473 92/258 (36%)
Tryp_SPc 28..262 CDD:238113 94/259 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.