DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and CG9372

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster


Alignment Length:350 Identity:121/350 - (34%)
Similarity:180/350 - (51%) Gaps:42/350 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 CRGPDTKPGNCVEIKECASLLNELRSRSQDATFANFLRASNAVC--QNKGTQVCCPTGQGITNTT 226
            |..|..:.|.|..|..|.  :.||::        :..|..:.:|  :.....:|| |.|..:|..
  Fly    87 CSTPLGESGRCRHIIYCR--MPELKN--------DVWRLVSQLCIIEKSSIGICC-TDQSTSNRF 140

  Fly   227 PAPSQIVPKNTDEIPRRLLNVEE--GCGSTVGYFKKIVGGEVSRKGAWPWIALLGYDDPSGSPFK 289
             :|..:...:.||  .|::|..|  |||.|...|.::.||..:....|||:|.|..:   |.||.
  Fly   141 -SPQVVTSADGDE--PRIVNKPEQRGCGITSRQFPRLTGGRPAEPDEWPWMAALLQE---GLPFV 199

  Fly   290 -CGGTLITARHVLTAAHCI----RQDLQFVRLGEHDLSTDTETGHVDINIARYVSHPDYNRRNGR 349
             |||.|||.||||||||||    ::|: ||||||::.....||...|..||..|.|.|||.:|..
  Fly   200 WCGGVLITDRHVLTAAHCIYKKNKEDI-FVRLGEYNTHMLNETRARDFRIANMVLHIDYNPQNYD 263

  Fly   350 SDMAILYLERNVEFTSKIAPICLPHTANLRQKSYVGYMPFVAGWGKTMEGGESAQVLNELQIPIY 414
            :|:||:.::|...|.:.|.|:|:|..    .:.:......|.|||....||..:.:|.|:.:|::
  Fly   264 NDIAIVRIDRATIFNTYIWPVCMPPV----NEDWSDRNAIVTGWGTQKFGGPHSNILMEVNLPVW 324

  Fly   415 DNKVCVQSYAKEKRYFSADQFDKAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVS 479
            ....|..|:.:        ......:|||...||:|:|||||||||::..|.|   |:..||:||
  Fly   325 KQSDCRSSFVQ--------HVPDTAMCAGFPEGGQDSCQGDSGGPLLVQLPNQ---RWVTIGIVS 378

  Fly   480 YGIGCARPNVPGVYSSTQYFMDWII 504
            :|:||.:...||:|:....::|||:
  Fly   379 WGVGCGQRGRPGIYTRVDRYLDWIL 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 10/53 (19%)
Tryp_SPc 260..503 CDD:214473 93/247 (38%)
Tryp_SPc 261..503 CDD:238113 93/246 (38%)
CG9372NP_649132.1 CLIP 87..132 CDD:197829 12/55 (22%)
Tryp_SPc 173..402 CDD:214473 93/247 (38%)
Tryp_SPc 176..402 CDD:238113 93/244 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.910

Return to query results.
Submit another query.