DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and CG6865

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster


Alignment Length:271 Identity:92/271 - (33%)
Similarity:139/271 - (51%) Gaps:43/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 KIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCIRQDL-QFVR-------L 316
            |||||..:.:...|::..|   ...|..| ||||:|:.|.:|||.|||...| ||::       :
  Fly    34 KIVGGSEAERNEMPYMVSL---MRRGGHF-CGGTIISERWILTAGHCICNGLQQFMKPAQIQGVV 94

  Fly   317 GEHD-------LSTDTETGHVDI-NIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICLP 373
            |.|.       :....:...||. ||   |.||.|:..:.:.|:|:|.|.:.:.|:|.|.|.|:.
  Fly    95 GLHSIREYLNGIGNGPDALRVDFKNI---VPHPQYDCNDVKHDIALLELVQPIRFSSHIQPSCVG 156

  Fly   374 HTANLR--QKSYVGYMPFVAGWGKTMEG---GESAQVLNELQIPIYDNKVCVQSYAKEKRYFSAD 433
            .....|  ::.|    ..|:|||.|.|.   .:.:.||.:..:.|::|:.|.:||   :....::
  Fly   157 SEEGHRSLEQEY----GTVSGWGWTHENQAENDRSDVLRKATVKIWNNEACERSY---RSLGKSN 214

  Fly   434 QFDKAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCARPNVPGVYSSTQY 498
            ...:..||||..:|..|:|..|||||||..|       .:|:||||.|||||||.:||:|:....
  Fly   215 TIGETQLCAGYENGQIDSCWADSGGPLMSKE-------HHLVGVVSTGIGCARPGLPGIYTRVSK 272

  Fly   499 FMDWIIQQVQD 509
            ::.| :|:|.|
  Fly   273 YVSW-MQKVID 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 88/263 (33%)
Tryp_SPc 261..503 CDD:238113 87/262 (33%)
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 88/262 (34%)
Tryp_SPc 35..280 CDD:238113 89/266 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.