DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and CG10663

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster


Alignment Length:349 Identity:106/349 - (30%)
Similarity:158/349 - (45%) Gaps:80/349 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 AVCQNKGTQVCCPTGQGITNTTPA---------PSQIVPKNTDEIPRRLLN-------------- 246
            |.|..:|: .|....|.....|||         |:..:.:...|.|...:|              
  Fly   417 AYCYTEGS-FCQQWLQTQFQKTPAFETRPGSGSPANAMRRMQSEQPEVSMNDLNYIMTGKGYRGP 480

  Fly   247 -----------VEEGCG-STVGYFKKIVGGEVSRKGAWPW-IALLGYDDPSGSPFK---CGGTLI 295
                       |..|.| .::....||:||..:|||.||| :|:|       :.||   ||||||
  Fly   481 EYTPLKLSCGIVRSGTGRRSMSNMLKIIGGRAARKGEWPWQVAIL-------NRFKEAFCGGTLI 538

  Fly   296 TARHVLTAAHCIRQDLQFVRLGEHDLSTDTETGHVDINIARYVSHPDYNRRNGRSDMAILYLERN 360
            ..|.|||||||:|:.| |||:|||:|:.:..| .:.:.:.:..:||::::|...||:|:|.|.:.
  Fly   539 APRWVLTAAHCVRKVL-FVRIGEHNLNYEDGT-EIQLRVMKSYTHPNFDKRTVDSDVALLRLPKA 601

  Fly   361 VEFTSKIAPICLPHTANLRQKSYVGYMPF----------VAGWGKTM-EGGESAQVLNELQIPIY 414
            |..|:.|...|||             .||          :.||||.. .......||::..:||.
  Fly   602 VNATTWIGYSCLP-------------QPFQALPKNVDCTIIGWGKRRNRDATGTSVLHKATVPII 653

  Fly   415 DNKVCVQSYAKEKRYFSADQFDKAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVS 479
            ..:.|      .|.|:.. ...|.:.|||...|..|||.|||||||:..:..:....:.:.|:.|
  Fly   654 PMQNC------RKVYYDY-TITKNMFCAGHQKGHIDTCAGDSGGPLLCRDTTKPNHPWTIFGITS 711

  Fly   480 YGIGCARPNVPGVYSSTQYFMDWI 503
            :|.|||:.|..|:|:....::||:
  Fly   712 FGDGCAQRNKFGIYAKVPNYVDWV 735

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 3/10 (30%)
Tryp_SPc 260..503 CDD:214473 90/257 (35%)
Tryp_SPc 261..503 CDD:238113 89/256 (35%)
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 90/257 (35%)
Tryp_SPc 507..735 CDD:238113 89/256 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.