DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and CG18180

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:251 Identity:72/251 - (28%)
Similarity:111/251 - (44%) Gaps:30/251 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 KIVGGEVSRKGAWPWI-ALLGYDDPSGSPFKCGGTLITARHVLTAAHCIRQDLQFVRLGEHDLST 323
            :||.|..:.:|..|:| .|....|.|.|.....||:|....:||||||:..|...:..|    |.
  Fly    35 RIVNGYPAPEGKAPYIVGLFIRTDGSNSGAVGAGTIIANDWILTAAHCLTGDYVEIHYG----SN 95

  Fly   324 DTETGHVDINIAR--YVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICLPHTANLRQKSYVGY 386
            ....|.....:.|  ::||||:..:.|| |:.::... :|:|...|..|.|| :.|.:...|...
  Fly    96 WGWNGAYRQTVRRDNFISHPDWPSQGGR-DIGLIRTP-HVDFNGLINKIPLP-SMNEQNDRYQDT 157

  Fly   387 MPFVAGWGKTMEGGESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCAGVLSGGKDT 451
            .....||| .|:.|..|..|..:.:.|..|..|.|:|..   ..|.|...:.       :.||..
  Fly   158 WCVACGWG-GMDNGNLADWLQCVDVQIISNSECEQAYGS---VASTDMCTRH-------ADGKSV 211

  Fly   452 CQGDSGGPLMLPEPYQGQLRFYLIGVVSY-GIGCARPNVPGVYSSTQYFMDWIIQQ 506
            |.|||||||:..:..:      |:||::: .:.|  .:.|..|:....:::||..|
  Fly   212 CGGDSGGPLVTHDNAR------LVGVITFASVSC--HDGPSGYTRVSDYLEWIRDQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 69/246 (28%)
Tryp_SPc 261..503 CDD:238113 69/245 (28%)
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 69/246 (28%)
Tryp_SPc 36..259 CDD:238113 71/248 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.