DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and KLKB1

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_011530232.1 Gene:KLKB1 / 3818 HGNCID:6371 Length:649 Species:Homo sapiens


Alignment Length:545 Identity:146/545 - (26%)
Similarity:215/545 - (39%) Gaps:128/545 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RRQVRQNCI-------TPE-------------------NYYGSC--VALTYCPQVVNIFQTTSRD 66
            :.:.|.||:       ||.                   :..|:|  .:|..|...:||||.    
Human   159 KAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGNCRTTSLCDCGCHMNIFQH---- 219

  Fly    67 RAQRYVIALQRSCGTRSINGDPVICCTEPRYNP------------VTERPRNPFF--------PS 111
                  :|.......|.:..|..:|.|...|:|            ..|..||...        ||
Human   220 ------LAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPS 278

  Fly   112 ESTFIGPQPPPEVPDNPFLIPTPRTTTTTTTTTPAPIPDTSAAPLIEPRG-----TVCRGPDTKP 171
            .||   ||      :|..   :..:..|...|.|.|. .:...|.::..|     |..:|.:...
Human   279 SST---PQ------ENTI---SGYSLLTCKRTLPEPC-HSKIYPGVDFGGEELNVTFVKGVNVCQ 330

  Fly   172 GNCVEIKECA----SLLNELRSRSQDATFANFLRASNAVCQNKGTQVCCPTGQGITNTTPAPSQI 232
            ..|.::..|.    |||.|   ..::.....|||.|   .....|::...| ||.:..:      
Human   331 ETCTKMIRCQFFTYSLLPE---DCKEEKCKCFLRLS---MDGSPTRIAYGT-QGSSGYS------ 382

  Fly   233 VPKNTDEIPRRLLNVEEGCGSTVGYFKKIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITA 297
                     .||.|..:....|.....:||||..|..|.|||...|.. ..:.....|||:||..
Human   383 ---------LRLCNTGDNSVCTTKTSTRIVGGTNSSWGEWPWQVSLQV-KLTAQRHLCGGSLIGH 437

  Fly   298 RHVLTAAHCI----RQDLQFVR---LGEHDLSTDTETGHVDINIARYVSHPDYNRRNGRSDMAIL 355
            :.|||||||.    .||:..:.   |...|::.||...    .|...:.|.:|....|..|:|::
Human   438 QWVLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFS----QIKEIIIHQNYKVSEGNHDIALI 498

  Fly   356 YLERNVEFTSKIAPICLPHTANLRQKSYVGYMPFVAGWGKTMEGGESAQVLNELQIPIYDNKVCV 420
            .|:..:.:|....|||||...:   .|.:....:|.|||.:.|.||...:|.::.||:..|:.|.
Human   499 KLQAPLNYTEFQKPICLPSKGD---TSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQ 560

  Fly   421 QSYAKEKRYFSADQFDKAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCA 485
            :.|...|       ..:.::|||...||||.|:|||||||:.  .:.|..|  |:|:.|:|.|||
Human   561 KRYQDYK-------ITQRMVCAGYKEGGKDACKGDSGGPLVC--KHNGMWR--LVGITSWGEGCA 614

  Fly   486 RPNVPGVYSSTQYFMDWIIQQVQDT 510
            |...||||:....:||||:::.|.:
Human   615 RREQPGVYTKVAEYMDWILEKTQSS 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829 15/83 (18%)
CLIP 164..216 CDD:288855 12/55 (22%)
Tryp_SPc 260..503 CDD:214473 87/249 (35%)
Tryp_SPc 261..503 CDD:238113 87/248 (35%)
KLKB1XP_011530232.1 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519 5/34 (15%)
APPLE 212..295 CDD:128519 21/104 (20%)
APPLE 303..386 CDD:128519 19/105 (18%)
Tryp_SPc 401..632 CDD:214473 87/249 (35%)
Tryp_SPc 402..632 CDD:238113 87/248 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.