DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and CG32270

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster


Alignment Length:273 Identity:86/273 - (31%)
Similarity:119/273 - (43%) Gaps:72/273 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 KIVGG------------EVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCIR---- 308
            :||||            .:.|:|                .|:|||:|:|.|.|||||||:.    
  Fly    30 RIVGGHPSDVWHQPHMVNIRRRG----------------NFECGGSLVTPRCVLTAAHCLNDGNP 78

  Fly   309 QDLQFVRLGEHDLSTDTETGHVDINIARYVSH---PD-YNRRNGRSDMAILYLERNVEFTSKIAP 369
            .|. .||.|...||        |:..:|||..   |. |:|.....|:|:|.|::.:: .|...|
  Fly    79 SDF-VVRGGVTYLS--------DMRNSRYVRKILMPSAYSRTTLDHDVALLQLKQPLQ-ASIAKP 133

  Fly   370 ICLPHTANLRQKSYVGYMPFVAGWGKTMEGGESAQVLNELQ---IPIYDNKVCVQSYAKEKRYFS 431
            |.|. ..:.|..|:|.    |:|||.|  ...|..:.|:||   :.:...:.|...|...:...|
  Fly   134 ISLA-VRSPRPGSFVR----VSGWGLT--DSSSTSLPNQLQSVHVQVMPQRECRDLYRGYRNITS 191

  Fly   432 ADQFDKAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIG--CARPNVPGVYS 494
                  ::.||.| .|.||.|.||||||::       .....|:||||:|..  ||..:.|||||
  Fly   192 ------SMFCASV-PGLKDACAGDSGGPVV-------NSNGILVGVVSWGRAHRCAARDSPGVYS 242

  Fly   495 STQYFMDWIIQQV 507
            ...|..|||...:
  Fly   243 DVSYLSDWIADNI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 84/267 (31%)
Tryp_SPc 261..503 CDD:238113 84/266 (32%)
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 84/267 (31%)
Tryp_SPc 31..254 CDD:238113 86/269 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.