DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and CG10764

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:269 Identity:85/269 - (31%)
Similarity:134/269 - (49%) Gaps:46/269 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 VEEGCGSTVGYFKKIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCIRQ-- 309
            :|..||  :....||.||:.:.:....|:|.:.    :.|.|:||||:|..|.||:||||:.:  
  Fly    26 LETPCG--ISTRPKISGGDDAAEPNSIWMAAIF----NSSDFQCGGTIIHMRFVLSAAHCLVRGY 84

  Fly   310 DLQFVRLGEHDLSTDTETGHVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICL-- 372
            || :||||..::: :....|..||:  :|.| |:.....|:|:.:|.|..::.:|.::.|||:  
  Fly    85 DL-YVRLGARNIN-EPAAVHTVINV--FVHH-DFIASEYRNDIGLLQLSESIVYTVRVQPICIFL 144

  Fly   373 -PHTANLRQKSYVGYMPFVA-GWGKTMEGGESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQF 435
             |......:|    ...|.| |||.  ..|:.:.:|..:.:.......|     |.|..|:   .
  Fly   145 DPALKGSVEK----LKTFRALGWGN--RNGKLSIMLQTIYLLHLKRNEC-----KRKLNFN---L 195

  Fly   436 DKAVLCAGVLSGGKDTCQGDSGGPL----MLP--EPYQGQLRFYLIGVVSYGIGCARPNVPGVYS 494
            :...:|||..:|  |||:|||||||    :.|  :.|:.||     |:||:|....|.  .|||:
  Fly   196 NSRQICAGTKNG--DTCRGDSGGPLSTNILFPSNKSYEVQL-----GIVSFGDPECRG--VGVYT 251

  Fly   495 STQYFMDWI 503
            ....::|||
  Fly   252 DVTSYVDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 80/254 (31%)
Tryp_SPc 261..503 CDD:238113 79/253 (31%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 80/254 (31%)
Tryp_SPc 38..263 CDD:238113 81/255 (32%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.