DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and Prss48

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001001650.1 Gene:Prss48 / 368202 MGIID:2685865 Length:312 Species:Mus musculus


Alignment Length:283 Identity:102/283 - (36%)
Similarity:141/283 - (49%) Gaps:46/283 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 NVEEGCGSTVGYFKKIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCIRQD 310
            |::..||..| :..:||||:.:..|.|||...|.:|    ....|||:||:...||||||||::.
Mouse    26 NLQSVCGRPV-HTGRIVGGQDAALGRWPWQVSLRFD----YTHSCGGSLISDHWVLTAAHCIKKT 85

  Fly   311 ----LQFVRLGEHD---LSTDTETGHVDINIARYVSH---PDYNRRNGRSDMAILYLERNVEFTS 365
                |..|.||..|   .||..|         .|||.   || ..|:..:|:|:|.|...|.|:|
Mouse    86 WYSFLYSVWLGSIDREYSSTGKE---------YYVSRIAIPD-KHRHTEADIALLKLSSRVTFSS 140

  Fly   366 KIAPICLPHTANLRQKSYVGYMPFVAGWGKTMEGGESAQVLNELQIPIYDNKVCVQSY------- 423
            .|.|||||   |:.::..|....:|.|||:..| |.....|.||::|:..::.|.|.|       
Mouse   141 VILPICLP---NISKQLTVPASCWVTGWGQNQE-GHYPSTLQELEVPVISSEACEQLYNPIGVFL 201

  Fly   424 AKEKRYFSADQFDKAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCARPN 488
            ...:|....|.|     |||.....||:|:|||||||..  ...|..|  |:||||:|:.|.: :
Mouse   202 PDLERVIKEDMF-----CAGERQSRKDSCKGDSGGPLSC--HIDGVWR--LMGVVSWGLECGK-D 256

  Fly   489 VPGVYSSTQYFMDWIIQQVQDTP 511
            :||||::..|:..||...:...|
Mouse   257 LPGVYTNVTYYQKWISAIISRAP 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 95/259 (37%)
Tryp_SPc 261..503 CDD:238113 95/258 (37%)
Prss48NP_001001650.1 Tryp_SPc 39..271 CDD:214473 95/259 (37%)
Tryp_SPc 40..274 CDD:238113 97/261 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.