DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and Tmprss4

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_038937788.1 Gene:Tmprss4 / 367074 RGDID:1305033 Length:478 Species:Rattus norvegicus


Alignment Length:397 Identity:114/397 - (28%)
Similarity:176/397 - (44%) Gaps:91/397 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 PRGTVCRG-----------------PDTKPGNCVEIKECASLLNEL---RSRSQDATFANFLRA- 202
            |||.:|.|                 |: |||..|.:.:..|.|..|   |.......|.||..| 
  Rat   113 PRGQMCDGHLDCASGEDEEHCVKNFPE-KPGVTVRLSKDRSTLQVLDAARGTWASVCFDNFTEAL 176

  Fly   203 SNAVCQNKGTQVCCPTGQGITNTTPA-------PSQI-----VPKNTDEIPRRLLNVEEGC--GS 253
            :...|:..|           .|:.||       |:|.     |..|:.|:  ::.|....|  ||
  Rat   177 AKTACRQMG-----------YNSQPAFGPVEMGPNQTLLVTPVTGNSQEL--QMQNGSRSCLSGS 228

  Fly   254 TVGY----------FKKIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCIR 308
            .|..          ..::|||..:...:|||...:.|:    ....|||:::....:||||||.|
  Rat   229 LVSLRCLDCGKSLKTTRVVGGVEASADSWPWQVSIQYN----KQHVCGGSILDHHWILTAAHCFR 289

  Fly   309 QDLQF----VRLGEHDLSTDTETGHVDINIAR-YVSHPDYNRRNGRSDMAILYLERNVEFTSKIA 368
            :.|..    ||.|.:.|....     .:.:|: :::.|: ..:....|:|::.|:..:.|:..:.
  Rat   290 KYLDVSSWKVRAGSNKLGNSP-----SLPVAKIFIAEPN-PLQPKEKDIALVKLKMPLTFSGSVR 348

  Fly   369 PICLPHTANLRQKSYVGYMP-FVAGWGKTME-GGESAQVLNELQIPIYDNKVCVQSYAKEKRYFS 431
            |||||.:    .:..:..|| :|.|||.|.| ||:.:..|.:..:.:.|:..|....|.:     
  Rat   349 PICLPFS----DEELIPTMPVWVIGWGFTEENGGKMSDTLLQASVQVIDSARCNAEDAYQ----- 404

  Fly   432 ADQFDKAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCARPNVPGVYSST 496
             .:....:||||...|||||||||||||||    |... ::.::|:||:|.||..|:.||||:..
  Rat   405 -GEVTAGMLCAGTPQGGKDTCQGDSGGPLM----YHYD-KWQVVGIVSWGYGCGSPSTPGVYTKV 463

  Fly   497 QYFMDWI 503
            ..::|||
  Rat   464 TAYLDWI 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 17/72 (24%)
Tryp_SPc 260..503 CDD:214473 79/249 (32%)
Tryp_SPc 261..503 CDD:238113 79/248 (32%)
Tmprss4XP_038937788.1 LDLa 99..133 CDD:238060 5/19 (26%)
SRCR_2 149..238 CDD:413346 23/101 (23%)
Tryp_SPc 245..470 CDD:214473 79/249 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.