DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and PRSS41

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001382429.1 Gene:PRSS41 / 360226 HGNCID:30715 Length:334 Species:Homo sapiens


Alignment Length:295 Identity:92/295 - (31%)
Similarity:143/295 - (48%) Gaps:53/295 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 PAPSQIVPKNTDEIPRRLLNVEEGCGSTVGYFKKIVGGEVSRKGAWPWIALLGYDDPSGSPFKCG 291
            ||.||     .:|:      :.|.||.. .....:.||..|.:|.|||.|.|..    ....:||
Human    49 PAESQ-----EEEL------LSEACGHR-EIHALVAGGVESARGRWPWQASLRL----RRRHRCG 97

  Fly   292 GTLITARHVLTAAHCIRQDLQ----FVRLGEHDLSTDTETGHVDINIARY-----VSHPDYNRRN 347
            |:|::.|.||:||||.::...    .|:|||  |::.....::....:||     :.:||   ..
Human    98 GSLLSRRWVLSAAHCFQKHYYPSEWTVQLGE--LTSRPTPWNLRAYSSRYKVQDIIVNPD---AL 157

  Fly   348 G--RSDMAILYLERNVEFTSKIAPICLPHTANLRQKSYVGYMP----FVAGWGKTMEGGESAQV- 405
            |  |:|:|:|.|..:|.:.:.|.|||:       :.|...::.    :|.|||.....|..... 
Human   158 GVLRNDIALLRLASSVTYNAYIQPICI-------ESSTFNFVHRPDCWVTGWGLISPSGTPLPPP 215

  Fly   406 --LNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQG 468
              |.|.|:.|.:|..|  :|..|:....:..:| ::.|||...|..|||:|||||||:..:  .|
Human   216 YNLREAQVTILNNTRC--NYLFEQPSSRSMIWD-SMFCAGAEDGSVDTCKGDSGGPLVCDK--DG 275

  Fly   469 QLRFYLIGVVSYGIGCARPNVPGVYSSTQYFMDWI 503
              .:|.:|:||:|:.|.:||.||||::...:..||
Human   276 --LWYQVGIVSWGMDCGQPNRPGVYTNISVYFHWI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 82/260 (32%)
Tryp_SPc 261..503 CDD:238113 82/259 (32%)
PRSS41NP_001382429.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.